F248698

General Info

Members Datasets Scaffolds Average Seq Length
166 136 332 75

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_101290879|Ga0307408_1012908792
Length 71
Sequence VGSVPVLEPREVVARHEPLGFVEIRQRGSHKQFADGRVTTVPMHAGRDISPTLLRQICRDTRMTVPEFVDS

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
134 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
135 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 1.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 0.6
Rhizosphere 91.57
Stem 0
Stem Tuber 0
Unclassified 34.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_101290879 3300031548 Bacteria 684
2 Ga0070670_102259813 3300005331 Bacteria 501
3 Ga0068869_100056646 3300005334 Unclassified 2859
4 Ga0070680_101882197 3300005336 Bacteria 518
5 Ga0070689_100015255 3300005340 Bacteria 5600
6 Ga0070669_101733481 3300005353 Unclassified 545
7 Ga0070714_101261165 3300005435 Unclassified 721
8 Ga0070662_100000908 3300005457 Bacteria 18078
9 Ga0070685_10013014 3300005466 Bacteria 4381
10 Ga0070706_101343784 3300005467 Bacteria 655
11 Ga0070706_101423315 3300005467 Unclassified 634
12 Ga0070707_100000223 3300005468 Bacteria 56622
13 Ga0070707_100872709 3300005468 Unclassified 864
14 Ga0070699_100075224 3300005518 Bacteria 2939
15 Ga0070679_100012456 3300005530 Bacteria 8127
16 Ga0070684_100000641 3300005535 Bacteria 24048
17 Ga0070672_100050385 3300005543 Unclassified 3242
18 Ga0070686_100172896 3300005544 Bacteria 1529
19 Ga0070693_100596990 3300005547 Bacteria 796
20 Ga0070664_100053627 3300005564 Bacteria 3419
21 Ga0068857_101102030 3300005577 Unclassified 767
22 Ga0068854_100118892 3300005578 Unclassified 2003
23 Ga0068856_100252018 3300005614 Unclassified 1780
24 Ga0068856_102232607 3300005614 Unclassified 556
25 Ga0068859_100010597 3300005617 Bacteria 9278
26 Ga0068861_101613450 3300005719 Bacteria 639
27 Ga0068861_102468230 3300005719 Unclassified 523
28 Ga0068858_100013516 3300005842 Bacteria 7702
29 Ga0081539_10175430 3300005985 Bacteria 1009
30 Ga0070717_10000075 3300006028 Bacteria 83509
31 Ga0070717_10163098 3300006028 Bacteria 1935
32 Ga0070717_11008824 3300006028 Bacteria 758
33 Ga0070716_100217232 3300006173 Bacteria 1282
34 Ga0070712_101209753 3300006175 Bacteria 657
35 Ga0097621_100221808 3300006237 Bacteria 1648
36 Ga0097621_100892106 3300006237 Bacteria 828
37 Ga0075428_102607460 3300006844 Bacteria 516
38 Ga0075429_100740496 3300006880 Bacteria 861
39 Ga0097620_100010597 3300006931 Bacteria 9278
40 Ga0105245_10057070 3300009098 Unclassified 3511
41 Ga0105245_10108154 3300009098 Bacteria 2582
42 Ga0105245_12393012 3300009098 Unclassified 582
43 Ga0105238_10110718 3300009551 Bacteria 2726
44 Ga0105239_10143734 3300010375 Bacteria 2659
45 Ga0157374_10931528 3300013296 Unclassified 887
46 Ga0157378_10000034 3300013297 Bacteria 120274
47 Ga0157378_10343207 3300013297 Unclassified 1457
48 Ga0163162_10774734 3300013306 Bacteria 1078
49 Ga0157372_11144188 3300013307 Archaea 900
50 Ga0157375_10001001 3300013308 Bacteria 24391
51 Ga0157375_10028598 3300013308 Bacteria 5228
52 Ga0157375_10540759 3300013308 Unclassified 1327
53 Ga0157376_11327595 3300014969 Bacteria 750
54 Ga0163161_10742892 3300017792 Unclassified 820
55 Ga0213876_10088562 3300021384 Bacteria 1639
56 Ga0213876_10337068 3300021384 Bacteria 802
57 Ga0207699_10524867 3300025906 Unclassified 857
58 Ga0207684_10801971 3300025910 Bacteria 796
59 Ga0207695_10097229 3300025913 Bacteria 2945
60 Ga0207693_11097227 3300025915 Bacteria 604
61 Ga0207663_11365845 3300025916 Bacteria 571
62 Ga0207660_10018643 3300025917 Bacteria 4630
63 Ga0207652_10005754 3300025921 Bacteria 10058
64 Ga0207646_11368442 3300025922 Unclassified 616
65 Ga0207687_10001735 3300025927 Bacteria 15020
66 Ga0207687_10697786 3300025927 Bacteria 861
67 Ga0207687_11230820 3300025927 Unclassified 643
68 Ga0207664_10870817 3300025929 Unclassified 809
69 Ga0207706_10001577 3300025933 Bacteria 22611
70 Ga0207670_10002652 3300025936 Bacteria 9415
71 Ga0207704_10908480 3300025938 Bacteria 741
72 Ga0207665_10066685 3300025939 Bacteria 2450
73 Ga0207665_11624473 3300025939 Unclassified 512
74 Ga0207691_10099553 3300025940 Unclassified 2596
75 Ga0207661_10000007 3300025944 Bacteria 471636
76 Ga0207651_10190623 3300025960 Bacteria 1635
77 Ga0207658_10112651 3300025986 Bacteria 2154
78 Ga0207703_10001040 3300026035 Bacteria 26564
79 Ga0207641_11043329 3300026088 Unclassified 815
80 Ga0207676_10755253 3300026095 Unclassified 946
81 Ga0207675_100487523 3300026118 Bacteria 1226
82 Ga0207428_10005807 3300027907 Bacteria 11443
83 Ga0265334_10223467 3300028573 Unclassified 651
84 Ga0265318_10020681 3300028577 Bacteria 2652
85 Ga0265325_10037487 3300031241 Bacteria 2563
86 Ga0265340_10113754 3300031247 Unclassified 1249
87 Ga0265313_10054246 3300031595 Bacteria 1904
88 Ga0265314_10166445 3300031711 Bacteria 1335
89 Ga0265342_10208055 3300031712 Bacteria 1059
90 Ga0316576_10695856 3300031727 Unclassified 737
91 Ga0316578_10023204 3300031728 Bacteria 3471
92 Ga0316578_10396829 3300031728 Bacteria 818
93 Ga0307410_10141874 3300031852 Bacteria 1778
94 Ga0307407_11356165 3300031903 Unclassified 559
95 Ga0307409_100018446 3300031995 Bacteria 4693
96 Ga0307409_100846695 3300031995 Bacteria 925
97 Ga0307416_102332147 3300032002 Bacteria 635
98 Ga0307416_103196842 3300032002 Bacteria 548
99 Ga0307414_10387633 3300032004 Bacteria 1210
100 Ga0307411_10316273 3300032005 Unclassified 1259
101 Ga0307415_100030443 3300032126 Bacteria 3465
102 Ga0307415_100872879 3300032126 Unclassified 827
103 Ga0307415_101980518 3300032126 Unclassified 567
104 Ga0316583_10034099 3300032133 Unclassified 1806
105 Ga0316580_10209359 3300032139 Bacteria 601
106 Ga0316593_10417132 3300032168 Unclassified 520
107 Ga0316592_1139352 3300033524 Unclassified 569
108 Ga0316596_1198032 3300033541 Bacteria 558
109 Ga0373944_0187942 3300035089 Unclassified 743
110 Ga0373923_0013645 3300035111 Bacteria 3033
111 Ga0373955_0351030 3300035172 Bacteria 893
112 Ga0373961_0010707 3300035241 Bacteria 2263
113 Ga0316574_0252787 3300035398 Bacteria 1126
114 Ga0316574_0667684 3300035398 Unclassified 639
115 Ga0373933_0974727 3300035724 Unclassified 558
116 Ga0373937_0313196 3300036401 Bacteria 1485
117 Ga0316582_0139372 3300036647 Bacteria 1634
118 Ga0316582_0249945 3300036647 Bacteria 1215
119 Ga0316582_1028389 3300036647 Bacteria 562
120 Ga0316584_0373468 3300036712 Bacteria 1020
121 Ga0316584_0517812 3300036712 Bacteria 836
122 Ga0316584_0567443 3300036712 Unclassified 790
123 Ga0373925_1681329 3300037068 Unclassified 518
124 Ga0400483_208272 3300039062 Unclassified 1039
125 Ga0400487_57562 3300039110 Bacteria 30026
126 Ga0436365_0950043 3300039437 Bacteria 1639
127 Ga0436365_1098318 3300039437 Unclassified 533
128 Ga0436365_1324241 3300039437 Unclassified 1198
129 Ga0436365_1499654 3300039437 Bacteria 935
130 Ga0436360_0286614 3300039438 Unclassified 1794
131 Ga0436361_0347428 3300039447 Bacteria 2122
132 Ga0436362_0455114 3300039453 Bacteria 637
133 Ga0451833_0950019 3300041491 Bacteria 534
134 Ga0451839_1354274 3300041496 Unclassified 508
135 Ga0453684_1686618 3300044712 Bacteria 648
136 Ga0451576_1686315 3300045051 Unclassified 656
137 Ga0495653_0413015 3300046463 Unclassified 855
138 Ga0495664_0553611 3300046477 Bacteria 685
139 Ga0495618_0134283 3300046514 Bacteria 1583
140 Ga0495628_1065463 3300046516 Unclassified 554
141 Ga0495640_0682229 3300046533 Unclassified 617
142 Ga0495657_0869430 3300046675 Unclassified 513
143 Ga0495604_0453805 3300047317 Bacteria 837
144 Ga0495680_0331158 3300047322 Bacteria 1064
145 Ga0495684_0910893 3300047471 Unclassified 565
146 Ga0496105_1056989 3300048908 Unclassified 605
147 Ga0501040_1175294 3300049576 Bacteria 557
148 Ga0501041_0824558 3300049577 Bacteria 595
149 Ga0501042_1043665 3300049578 Bacteria 596
150 Ga0501067_0018404 3300049583 Bacteria 3870
151 Ga0501072_0879681 3300049588 Bacteria 700
152 Ga0501073_0647963 3300049589 Bacteria 729
153 Ga0501075_0649955 3300049591 Unclassified 804
154 Ga0501080_1562878 3300049742 Bacteria 559
155 Ga0501035_1006560 3300049822 Bacteria 655
156 Ga0501045_0175613 3300049824 Bacteria 1596
157 Ga0501045_0709445 3300049824 Unclassified 742
158 nmdc:mga09592_1581622_c1 3300050508 Unclassified 531
159 Ga0495601_0395413 3300053077 Unclassified 896
160 Ga0495612_0345542 3300053078 Unclassified 671
161 Ga0495595_0050593 3300053084 Bacteria 1925
162 Ga0495619_0599910 3300053085 Bacteria 753
163 Ga0500555_000178 3300053103 Bacteria 29196
164 Ga0500645_000293 3300053730 Bacteria 35759
165 Ga0500599_001615 3300053736 Bacteria 2617
166 Ga0501082_0330722 3300060353 Bacteria 1328
167 Ga0307408_101290879
168 Ga0070670_102259813
169 Ga0068869_100056646
170 Ga0070680_101882197
171 Ga0070689_100015255
172 Ga0070669_101733481
173 Ga0070714_101261165
174 Ga0070662_100000908
175 Ga0070685_10013014
176 Ga0070706_101343784
177 Ga0070706_101423315
178 Ga0070707_100000223
179 Ga0070707_100872709
180 Ga0070699_100075224
181 Ga0070679_100012456
182 Ga0070684_100000641
183 Ga0070672_100050385
184 Ga0070686_100172896
185 Ga0070693_100596990
186 Ga0070664_100053627
187 Ga0068857_101102030
188 Ga0068854_100118892
189 Ga0068856_100252018
190 Ga0068856_102232607
191 Ga0068859_100010597
192 Ga0068861_101613450
193 Ga0068861_102468230
194 Ga0068858_100013516
195 Ga0081539_10175430
196 Ga0070717_10000075
197 Ga0070717_10163098
198 Ga0070717_11008824
199 Ga0070716_100217232
200 Ga0070712_101209753
201 Ga0097621_100221808
202 Ga0097621_100892106
203 Ga0075428_102607460
204 Ga0075429_100740496
205 Ga0097620_100010597
206 Ga0105245_10057070
207 Ga0105245_10108154
208 Ga0105245_12393012
209 Ga0105238_10110718
210 Ga0105239_10143734
211 Ga0157374_10931528
212 Ga0157378_10000034
213 Ga0157378_10343207
214 Ga0163162_10774734
215 Ga0157372_11144188
216 Ga0157375_10001001
217 Ga0157375_10028598
218 Ga0157375_10540759
219 Ga0157376_11327595
220 Ga0163161_10742892
221 Ga0213876_10088562
222 Ga0213876_10337068
223 Ga0207699_10524867
224 Ga0207684_10801971
225 Ga0207695_10097229
226 Ga0207693_11097227
227 Ga0207663_11365845
228 Ga0207660_10018643
229 Ga0207652_10005754
230 Ga0207646_11368442
231 Ga0207687_10001735
232 Ga0207687_10697786
233 Ga0207687_11230820
234 Ga0207664_10870817
235 Ga0207706_10001577
236 Ga0207670_10002652
237 Ga0207704_10908480
238 Ga0207665_10066685
239 Ga0207665_11624473
240 Ga0207691_10099553
241 Ga0207661_10000007
242 Ga0207651_10190623
243 Ga0207658_10112651
244 Ga0207703_10001040
245 Ga0207641_11043329
246 Ga0207676_10755253
247 Ga0207675_100487523
248 Ga0207428_10005807
249 Ga0265334_10223467
250 Ga0265318_10020681
251 Ga0265325_10037487
252 Ga0265340_10113754
253 Ga0265313_10054246
254 Ga0265314_10166445
255 Ga0265342_10208055
256 Ga0316576_10695856
257 Ga0316578_10023204
258 Ga0316578_10396829
259 Ga0307410_10141874
260 Ga0307407_11356165
261 Ga0307409_100018446
262 Ga0307409_100846695
263 Ga0307416_102332147
264 Ga0307416_103196842
265 Ga0307414_10387633
266 Ga0307411_10316273
267 Ga0307415_100030443
268 Ga0307415_100872879
269 Ga0307415_101980518
270 Ga0316583_10034099
271 Ga0316580_10209359
272 Ga0316593_10417132
273 Ga0316592_1139352
274 Ga0316596_1198032
275 Ga0373944_0187942
276 Ga0373923_0013645
277 Ga0373955_0351030
278 Ga0373961_0010707
279 Ga0316574_0252787
280 Ga0316574_0667684
281 Ga0373933_0974727
282 Ga0373937_0313196
283 Ga0316582_0139372
284 Ga0316582_0249945
285 Ga0316582_1028389
286 Ga0316584_0373468
287 Ga0316584_0517812
288 Ga0316584_0567443
289 Ga0373925_1681329
290 Ga0400483_208272
291 Ga0400487_57562
292 Ga0436365_0950043
293 Ga0436365_1098318
294 Ga0436365_1324241
295 Ga0436365_1499654
296 Ga0436360_0286614
297 Ga0436361_0347428
298 Ga0436362_0455114
299 Ga0451833_0950019
300 Ga0451839_1354274
301 Ga0453684_1686618
302 Ga0451576_1686315
303 Ga0495653_0413015
304 Ga0495664_0553611
305 Ga0495618_0134283
306 Ga0495628_1065463
307 Ga0495640_0682229
308 Ga0495657_0869430
309 Ga0495604_0453805
310 Ga0495680_0331158
311 Ga0495684_0910893
312 Ga0496105_1056989
313 Ga0501040_1175294
314 Ga0501041_0824558
315 Ga0501042_1043665
316 Ga0501067_0018404
317 Ga0501072_0879681
318 Ga0501073_0647963
319 Ga0501075_0649955
320 Ga0501080_1562878
321 Ga0501035_1006560
322 Ga0501045_0175613
323 Ga0501045_0709445
324 nmdc:mga09592_1581622_c1
325 Ga0495601_0395413
326 Ga0495612_0345542
327 Ga0495595_0050593
328 Ga0495619_0599910
329 Ga0500555_000178
330 Ga0500645_000293
331 Ga0500599_001615
332 Ga0501082_0330722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

9

63

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9366 4 72
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.8991 4 72
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8724 7 65
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8463 7 65
2g7j-assembly1.cif.gz_A solution nmr structure of the putative cytoplasmic protein ygac from salmonella typhimurium. northeast structural genomics target str72. 0.8207 5 44
ID Description Score Start End Superfamily
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9504 7 65 3.30.920.30
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9352 7 65 3.30.920.30
1whzA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9309 5 72 3.30.920.30
1whzA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9051 5 72 3.30.920.30
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8724 7 65 3.30.920.30
ID Description Score Start End GO Terms
AF-L0DTT1-F1-model_v4 Toxin-antitoxin system, toxin component, HicA family 0.9916 19 71 GO:0003729
GO:0004519
AF-A0A1Z9JFP7-F1-model_v4 Addiction module toxin, HicA family 0.9843 6 74 GO:0003729
GO:0004519
AF-A0A3D0P9U3-F1-model_v4 Addiction module toxin, HicA family 0.9834 6 74 GO:0003729
GO:0004519
AF-A0A1Z8NGE1-F1-model_v4 Toxin HicA 0.9822 6 74 GO:0003729
GO:0004519
AF-A0A7X7N0M5-F1-model_v4 Addiction module toxin, HicA family 0.9816 4 66 GO:0003729
GO:0004519

Map