F248672

General Info

Members Datasets Scaffolds Average Seq Length
166 86 155 202

Family's Representative Sequence

Representative Sequence 3300030522|Ga0307512_10058849|Ga0307512_100588492
Length 243
Sequence MRGTLPGHVSRLAALLGRATADAAVSHSVDIEAGGTPGTLRHMDVREMAVPGAFEFTPRTFPDERGVFVSPYQEAAFVKAVGHPLRLAQTNHSRSRRGSVRGLHFADVPPGQAKYVYCPVGALLDVVVDIRVGSPTFGTWDVVRLDPVDFRAVYVPEGVGHGFVALEDDTVISYLCSTSYNPVAEHGLSPVDPALGLPWPSDLSLLLSPKDTAAPLLADAESAGLLPSYADCMARYRELRSLG

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2582580736 Prauserella sp. Am3 Isolate Unclassified
3 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
4 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
5 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
6 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
7 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
8 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
50 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
51 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
52 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
76 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
77 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
78 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
79 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
80 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
81 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
82 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
83 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
84 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
85 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
86 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.17
Metatranscriptomes 1.2
Isolates 6.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 1.2
Rhizosphere 86.14
Stem 0
Stem Tuber 0
Unclassified 12.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10262470 3300003323 Bacteria 1695
2 Ga0070658_10003877 3300005327 Bacteria 12264
3 Ga0070680_100000042 3300005336 Bacteria 65213
4 Ga0070680_100000111 3300005336 Bacteria 47136
5 Ga0070680_100147918 3300005336 Bacteria 1972
6 Ga0070682_100167211 3300005337 Bacteria 1525
7 Ga0070682_100307785 3300005337 Bacteria 1165
8 Ga0070660_100010827 3300005339 Bacteria 6456
9 Ga0070667_100003440 3300005367 Bacteria 13482
10 Ga0070663_100295325 3300005455 Bacteria 1295
11 Ga0070681_10000056 3300005458 Bacteria 79899
12 Ga0070681_10000299 3300005458 Bacteria 40221
13 Ga0070681_10391783 3300005458 Bacteria 1300
14 Ga0070679_100000140 3300005530 Bacteria 58509
15 Ga0070679_100000736 3300005530 Bacteria 28309
16 Ga0070679_100309485 3300005530 Bacteria 1530
17 Ga0070679_100809819 3300005530 Bacteria 880
18 Ga0070684_100607293 3300005535 Bacteria 1017
19 Ga0068853_100014414 3300005539 Bacteria 6472
20 Ga0068852_100133272 3300005616 Bacteria 2290
21 Ga0157373_10108891 3300013100 Bacteria 1948
22 Ga0157369_10275713 3300013105 Bacteria 1752
23 Ga0157372_10418002 3300013307 Bacteria 1563
24 Ga0206353_10206701 3300020082 Bacteria 10401
25 Ga0206353_10922491 3300020082 Bacteria 5833
26 Ga0213873_10045591 3300021358 Bacteria 1144
27 Ga0213876_10000487 3300021384 Bacteria 31447
28 Ga0207705_10001286 3300025909 Bacteria 20143
29 Ga0207707_10000196 3300025912 Bacteria 63970
30 Ga0207707_10302329 3300025912 Bacteria 1383
31 Ga0207660_10000101 3300025917 Bacteria 47860
32 Ga0207660_10007606 3300025917 Bacteria 7012
33 Ga0207660_10156353 3300025917 Bacteria 1755
34 Ga0207652_10000110 3300025921 Bacteria 89235
35 Ga0207652_10000143 3300025921 Bacteria 76508
36 Ga0207652_10155855 3300025921 Bacteria 2046
37 Ga0207694_10011897 3300025924 Bacteria 6562
38 Ga0207700_10905882 3300025928 Bacteria 789
39 Ga0207664_10001960 3300025929 Bacteria 13565
40 Ga0207661_10522071 3300025944 Bacteria 1086
41 Ga0207658_10003378 3300025986 Bacteria 11293
42 Ga0207639_10016607 3300026041 Bacteria 5211
43 Ga0207698_10111453 3300026142 Bacteria 2294
44 Ga0307512_10058849 3300030522 Bacteria 2988
45 Ga0307513_10360721 3300031456 Bacteria 1198
46 Ga0307408_100673142 3300031548 Bacteria 927
47 Ga0307408_101066677 3300031548 Bacteria 748
48 Ga0307405_10199574 3300031731 Bacteria 1452
49 Ga0307413_10000652 3300031824 Bacteria 11745
50 Ga0307413_10147726 3300031824 Bacteria 1634
51 Ga0307413_10226630 3300031824 Bacteria 1369
52 Ga0307410_10095945 3300031852 Bacteria 2115
53 Ga0307410_10105689 3300031852 Bacteria 2027
54 Ga0307410_10283148 3300031852 Bacteria 1302
55 Ga0307407_10028548 3300031903 Bacteria 2984
56 Ga0307407_10125034 3300031903 Bacteria 1637
57 Ga0307409_100023910 3300031995 Bacteria 4246
58 Ga0307409_100025006 3300031995 Bacteria 4179
59 Ga0307409_100141303 3300031995 Bacteria 2075
60 Ga0307409_100229725 3300031995 Bacteria 1681
61 Ga0307409_100486755 3300031995 Bacteria 1198
62 Ga0307409_100503508 3300031995 Bacteria 1180
63 Ga0307416_100014744 3300032002 Bacteria 5371
64 Ga0307416_100039287 3300032002 Bacteria 3662
65 Ga0307416_100244285 3300032002 Bacteria 1742
66 Ga0307416_100742875 3300032002 Bacteria 1073
67 Ga0307416_100906903 3300032002 Bacteria 982
68 Ga0307416_101037009 3300032002 Bacteria 924
69 Ga0307416_101366852 3300032002 Bacteria 814
70 Ga0307414_10072351 3300032004 Bacteria 2490
71 Ga0307414_10101867 3300032004 Bacteria 2163
72 Ga0307414_10273953 3300032004 Bacteria 1415
73 Ga0307414_10491680 3300032004 Bacteria 1084
74 Ga0307415_100109542 3300032126 Bacteria 2046
75 Ga0307415_100210681 3300032126 Bacteria 1550
76 Ga0307415_100344922 3300032126 Bacteria 1251
77 Ga0307415_100372978 3300032126 Bacteria 1209
78 Ga0307415_100460238 3300032126 Bacteria 1102
79 Ga0307415_100672010 3300032126 Bacteria 931
80 Ga0307507_10006482 3300033179 Bacteria 17943
81 Ga0307507_10087453 3300033179 Bacteria 2694
82 Ga0307510_10064075 3300033180 Bacteria 3735
83 Ga0373940_0140899 3300035088 Bacteria 762
84 Ga0373956_0043981 3300035119 Bacteria 1989
85 Ga0395900_0073756 3300037418 Bacteria 3509
86 Ga0395900_0129189 3300037418 Bacteria 2590
87 Ga0395898_0441411 3300037466 Bacteria 1240
88 Ga0395898_0498506 3300037466 Bacteria 1158
89 Ga0395898_0702105 3300037466 Bacteria 953
90 Ga0395901_0129877 3300038443 Bacteria 2647
91 Ga0436365_1195958 3300039437 Bacteria 52983
92 Ga0436365_1530443 3300039437 Bacteria 3729
93 Ga0436363_0334485 3300039450 Bacteria 683
94 Ga0436362_0833790 3300039453 Bacteria 1168
95 Ga0466972_0006492 3300044658 Bacteria 5874
96 Ga0466965_0063877 3300044683 Bacteria 1843
97 Ga0466965_0079101 3300044683 Bacteria 1661
98 Ga0466966_0033072 3300044684 Bacteria 3348
99 Ga0466966_0095567 3300044684 Bacteria 1841
100 Ga0466961_0015172 3300044693 Bacteria 4948
101 Ga0466961_0050093 3300044693 Bacteria 2668
102 Ga0466961_0079856 3300044693 Bacteria 2071
103 Ga0466961_0151197 3300044693 Bacteria 1449
104 Ga0466961_0328846 3300044693 Bacteria 932
105 Ga0466963_0013605 3300044694 Bacteria 5000
106 Ga0466963_0082937 3300044694 Bacteria 2174
107 Ga0466963_0106857 3300044694 Bacteria 1919
108 Ga0466963_0197735 3300044694 Bacteria 1406
109 Ga0466963_0243194 3300044694 Bacteria 1262
110 Ga0466963_0404666 3300044694 Bacteria 962
111 Ga0466963_0439456 3300044694 Bacteria 920
112 Ga0466964_0075041 3300044706 Bacteria 1439
113 Ga0466971_0029271 3300044719 Bacteria 2463
114 Ga0466970_0061179 3300044765 Bacteria 2017
115 Ga0466970_0066651 3300044765 Bacteria 1933
116 Ga0466970_0164485 3300044765 Bacteria 1228
117 Ga0466957_0196828 3300044842 Bacteria 1322
118 Ga0466960_0008394 3300044901 Bacteria 4228
119 Ga0466960_0042858 3300044901 Bacteria 2150
120 Ga0466960_0045537 3300044901 Bacteria 2096
121 Ga0466960_0069080 3300044901 Bacteria 1754
122 Ga0466960_0222414 3300044901 Bacteria 1039
123 Ga0466960_0296248 3300044901 Bacteria 910
124 Ga0466960_0602313 3300044901 Bacteria 652
125 Ga0466959_0055466 3300045049 Bacteria 2893
126 Ga0466959_0148610 3300045049 Bacteria 1653
127 Ga0466959_0317986 3300045049 Bacteria 1064
128 Ga0466959_0451301 3300045049 Bacteria 872
129 Ga0466959_0545175 3300045049 Bacteria 782
130 Ga0466958_0075903 3300045836 Bacteria 2062
131 Ga0466958_0096052 3300045836 Bacteria 1838
132 Ga0466958_0136084 3300045836 Bacteria 1545
133 Ga0466958_0154004 3300045836 Bacteria 1450
134 Ga0466958_0394315 3300045836 Bacteria 893
135 Ga0466967_0002745 3300045976 Bacteria 11136
136 Ga0466967_0037864 3300045976 Bacteria 4132
137 Ga0466967_0040872 3300045976 Bacteria 3994
138 Ga0466967_0105798 3300045976 Bacteria 2578
139 Ga0466967_0178615 3300045976 Bacteria 2001
140 Ga0466967_0337711 3300045976 Bacteria 1456
141 Ga0466967_0360539 3300045976 Bacteria 1408
142 Ga0466967_0788615 3300045976 Bacteria 943
143 Ga0495621_0169000 3300046539 Bacteria 868
144 Ga0496111_0535081 3300048914 Bacteria 861
145 Ga0496112_0155595 3300048915 Bacteria 2253
146 Ga0496122_0000522 3300048925 Bacteria 79377
147 Ga0496123_0000251 3300048926 Bacteria 108664
148 Ga0496124_0002708 3300048927 Bacteria 22632
149 Ga0496125_0011614 3300048928 Bacteria 8797
150 Ga0496126_0002688 3300048929 Bacteria 23495
151 nmdc:mga09592_151122_c1 3300050508 Bacteria 2003
152 Ga0500644_0004968 3300053088 Bacteria 3345
153 Ga0501084_0327464 3300054114 Bacteria 1294
154 Ga0466962_0052472 3300061719 Bacteria 1949
155 Ga0466962_0109413 3300061719 Bacteria 1330

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0317986 Ga0466959_0317986_275_892 181
2 3300045836 Ga0466958_0394315 Ga0466958_0394315_124_732 181
3 3300061719 Ga0466962_0109413 Ga0466962_0109413_580_1197 181
4 3300037418 Ga0395900_0129189 Ga0395900_0129189_1192_1800 185
5 3300037466 Ga0395898_0441411 Ga0395898_0441411_119_727 185
6 3300031995 Ga0307409_100486755 Ga0307409_1004867552 191
7 3300044693 Ga0466961_0328846 Ga0466961_0328846_171_761 193
8 iso_pu_bacteria 2554235005 2554257921 193
9 3300048914 Ga0496111_0535081 Ga0496111_0535081_133_720 194
10 3300048925 Ga0496122_0000522 Ga0496122_0000522_41491_42078 194
11 3300048926 Ga0496123_0000251 Ga0496123_0000251_73279_73866 194
12 3300048927 Ga0496124_0002708 Ga0496124_0002708_17211_17798 194
13 3300048928 Ga0496125_0011614 Ga0496125_0011614_4592_5179 194
14 3300048929 Ga0496126_0002688 Ga0496126_0002688_21945_22532 194
15 iso_pu_bacteria 2582580736 2583152620 194
16 iso_pu_bacteria 2775506925 2776372820 194
17 iso_pu_bacteria 2791354901 2791910395 194
18 iso_pu_bacteria 2863067949 2863070750 194
19 iso_pu_bacteria 2866612099 2866613497 194
20 iso_pu_bacteria 2891326441 2891330161 194
21 iso_pu_bacteria 8003314358 8003315828 194
22 iso_pu_bacteria 8047710418 8047717039 194
23 iso_pu_bacteria 8056207758 8056212751 194
24 3300025944 Ga0207661_10522071 Ga0207661_105220712 196
25 3300044693 Ga0466961_0050093 Ga0466961_0050093_1910_2587 196
26 3300044901 Ga0466960_0296248 Ga0466960_0296248_55_693 196
27 3300045049 Ga0466959_0451301 Ga0466959_0451301_39_716 196
28 3300013105 Ga0157369_10275713 Ga0157369_102757132 197
29 3300013307 Ga0157372_10418002 Ga0157372_104180022 197
30 3300053088 Ga0500644_0004968 Ga0500644_0004968_2039_2641 197
31 iso_pu_bacteria 2622736605 2623501673 197
32 3300003323 rootH1_10262470 rootH1_102624702 198
33 3300005327 Ga0070658_10003877 Ga0070658_100038774 198
34 3300005336 Ga0070680_100000042 Ga0070680_10000004228 198
35 3300005336 Ga0070680_100000111 Ga0070680_10000011158 198
36 3300005336 Ga0070680_100147918 Ga0070680_1001479183 198
37 3300005337 Ga0070682_100167211 Ga0070682_1001672112 198
38 3300005337 Ga0070682_100307785 Ga0070682_1003077852 198
39 3300005339 Ga0070660_100010827 Ga0070660_1000108276 198
40 3300005367 Ga0070667_100003440 Ga0070667_1000034406 198
41 3300005455 Ga0070663_100295325 Ga0070663_1002953252 198
42 3300005458 Ga0070681_10000056 Ga0070681_1000005628 198
43 3300005458 Ga0070681_10000299 Ga0070681_1000029914 198
44 3300005458 Ga0070681_10391783 Ga0070681_103917832 198
45 3300005530 Ga0070679_100000140 Ga0070679_10000014010 198
46 3300005530 Ga0070679_100000736 Ga0070679_10000073636 198
47 3300005530 Ga0070679_100309485 Ga0070679_1003094852 198
48 3300005530 Ga0070679_100809819 Ga0070679_1008098191 198
49 3300005535 Ga0070684_100607293 Ga0070684_1006072932 198
50 3300005539 Ga0068853_100014414 Ga0068853_1000144148 198
51 3300005616 Ga0068852_100133272 Ga0068852_1001332723 198
52 3300013100 Ga0157373_10108891 Ga0157373_101088912 198
53 3300020082 Ga0206353_10206701 Ga0206353_102067012 198
54 3300020082 Ga0206353_10922491 Ga0206353_109224912 198
55 3300021358 Ga0213873_10045591 Ga0213873_100455911 198
56 3300021384 Ga0213876_10000487 Ga0213876_1000048722 198
57 3300025909 Ga0207705_10001286 Ga0207705_1000128626 198
58 3300025912 Ga0207707_10000196 Ga0207707_1000019625 198
59 3300025912 Ga0207707_10302329 Ga0207707_103023292 198
60 3300025917 Ga0207660_10000101 Ga0207660_100001018 198
61 3300025917 Ga0207660_10007606 Ga0207660_100076067 198
62 3300025917 Ga0207660_10156353 Ga0207660_101563532 198
63 3300025921 Ga0207652_10000110 Ga0207652_1000011025 198
64 3300025921 Ga0207652_10000143 Ga0207652_1000014314 198
65 3300025921 Ga0207652_10155855 Ga0207652_101558552 198
66 3300025924 Ga0207694_10011897 Ga0207694_100118975 198
67 3300025928 Ga0207700_10905882 Ga0207700_109058821 198
68 3300025929 Ga0207664_10001960 Ga0207664_100019608 198
69 3300025986 Ga0207658_10003378 Ga0207658_100033786 198
70 3300026041 Ga0207639_10016607 Ga0207639_100166073 198
71 3300026142 Ga0207698_10111453 Ga0207698_101114534 198
72 3300030522 Ga0307512_10058849 Ga0307512_100588492 198
73 3300031456 Ga0307513_10360721 Ga0307513_103607212 198
74 3300031548 Ga0307408_100673142 Ga0307408_1006731421 198
75 3300031548 Ga0307408_101066677 Ga0307408_1010666771 198
76 3300031731 Ga0307405_10199574 Ga0307405_101995742 198
77 3300031824 Ga0307413_10000652 Ga0307413_1000065217 198
78 3300031824 Ga0307413_10147726 Ga0307413_101477262 198
79 3300031824 Ga0307413_10226630 Ga0307413_102266303 198
80 3300031852 Ga0307410_10095945 Ga0307410_100959452 198
81 3300031852 Ga0307410_10105689 Ga0307410_101056892 198
82 3300031852 Ga0307410_10283148 Ga0307410_102831482 198
83 3300031903 Ga0307407_10028548 Ga0307407_100285483 198
84 3300031903 Ga0307407_10125034 Ga0307407_101250342 198
85 3300031995 Ga0307409_100023910 Ga0307409_1000239102 198
86 3300031995 Ga0307409_100025006 Ga0307409_1000250064 198
87 3300031995 Ga0307409_100141303 Ga0307409_1001413032 198
88 3300031995 Ga0307409_100229725 Ga0307409_1002297252 198
89 3300031995 Ga0307409_100503508 Ga0307409_1005035082 198
90 3300032002 Ga0307416_100014744 Ga0307416_1000147443 198
91 3300032002 Ga0307416_100039287 Ga0307416_1000392873 198
92 3300032002 Ga0307416_100244285 Ga0307416_1002442852 198
93 3300032002 Ga0307416_100742875 Ga0307416_1007428752 198
94 3300032002 Ga0307416_100906903 Ga0307416_1009069031 198
95 3300032002 Ga0307416_101037009 Ga0307416_1010370092 198
96 3300032002 Ga0307416_101366852 Ga0307416_1013668521 198
97 3300032004 Ga0307414_10072351 Ga0307414_100723513 198
98 3300032004 Ga0307414_10101867 Ga0307414_101018673 198
99 3300032004 Ga0307414_10273953 Ga0307414_102739532 198
100 3300032004 Ga0307414_10491680 Ga0307414_104916802 198
101 3300032126 Ga0307415_100109542 Ga0307415_1001095422 198
102 3300032126 Ga0307415_100210681 Ga0307415_1002106812 198
103 3300032126 Ga0307415_100344922 Ga0307415_1003449221 198
104 3300032126 Ga0307415_100372978 Ga0307415_1003729783 198
105 3300032126 Ga0307415_100460238 Ga0307415_1004602382 198
106 3300032126 Ga0307415_100672010 Ga0307415_1006720102 198
107 3300033179 Ga0307507_10006482 Ga0307507_100064826 198
108 3300033179 Ga0307507_10087453 Ga0307507_100874532 198
109 3300033180 Ga0307510_10064075 Ga0307510_100640753 198
110 3300035088 Ga0373940_0140899 Ga0373940_0140899_46_675 198
111 3300035119 Ga0373956_0043981 Ga0373956_0043981_1280_1903 198
112 3300037418 Ga0395900_0073756 Ga0395900_0073756_986_1585 198
113 3300037466 Ga0395898_0498506 Ga0395898_0498506_420_1022 198
114 3300037466 Ga0395898_0702105 Ga0395898_0702105_285_884 198
115 3300038443 Ga0395901_0129877 Ga0395901_0129877_1310_1924 198
116 3300039437 Ga0436365_1195958 Ga0436365_1195958_46774_47376 198
117 3300039437 Ga0436365_1530443 Ga0436365_1530443_1875_2474 198
118 3300039450 Ga0436363_0334485 Ga0436363_0334485_53_652 198
119 3300039453 Ga0436362_0833790 Ga0436362_0833790_528_1130 198
120 3300044658 Ga0466972_0006492 Ga0466972_0006492_5124_5729 198
121 3300044683 Ga0466965_0063877 Ga0466965_0063877_1171_1776 198
122 3300044683 Ga0466965_0079101 Ga0466965_0079101_251_853 198
123 3300044684 Ga0466966_0033072 Ga0466966_0033072_471_1070 198
124 3300044684 Ga0466966_0095567 Ga0466966_0095567_144_743 198
125 3300044693 Ga0466961_0015172 Ga0466961_0015172_191_790 198
126 3300044693 Ga0466961_0079856 Ga0466961_0079856_309_914 198
127 3300044693 Ga0466961_0151197 Ga0466961_0151197_540_1139 198
128 3300044694 Ga0466963_0013605 Ga0466963_0013605_1105_1722 198
129 3300044694 Ga0466963_0082937 Ga0466963_0082937_256_861 198
130 3300044694 Ga0466963_0106857 Ga0466963_0106857_34_705 198
131 3300044694 Ga0466963_0197735 Ga0466963_0197735_772_1377 198
132 3300044694 Ga0466963_0243194 Ga0466963_0243194_380_979 198
133 3300044694 Ga0466963_0404666 Ga0466963_0404666_218_820 198
134 3300044694 Ga0466963_0439456 Ga0466963_0439456_232_849 198
135 3300044706 Ga0466964_0075041 Ga0466964_0075041_550_1155 198
136 3300044719 Ga0466971_0029271 Ga0466971_0029271_399_1004 198
137 3300044765 Ga0466970_0061179 Ga0466970_0061179_917_1522 198
138 3300044765 Ga0466970_0066651 Ga0466970_0066651_1161_1760 198
139 3300044765 Ga0466970_0164485 Ga0466970_0164485_175_780 198
140 3300044842 Ga0466957_0196828 Ga0466957_0196828_328_933 198
141 3300044901 Ga0466960_0008394 Ga0466960_0008394_413_1024 198
142 3300044901 Ga0466960_0042858 Ga0466960_0042858_151_756 198
143 3300044901 Ga0466960_0045537 Ga0466960_0045537_704_1333 198
144 3300044901 Ga0466960_0069080 Ga0466960_0069080_384_989 198
145 3300044901 Ga0466960_0222414 Ga0466960_0222414_331_936 198
146 3300044901 Ga0466960_0602313 Ga0466960_0602313_25_639 198
147 3300045049 Ga0466959_0055466 Ga0466959_0055466_817_1416 198
148 3300045049 Ga0466959_0148610 Ga0466959_0148610_455_1090 198
149 3300045049 Ga0466959_0545175 Ga0466959_0545175_78_743 198
150 3300045836 Ga0466958_0075903 Ga0466958_0075903_1249_1866 198
151 3300045836 Ga0466958_0096052 Ga0466958_0096052_526_1128 198
152 3300045836 Ga0466958_0136084 Ga0466958_0136084_373_978 198
153 3300045836 Ga0466958_0154004 Ga0466958_0154004_372_971 198
154 3300045976 Ga0466967_0002745 Ga0466967_0002745_9490_10119 198
155 3300045976 Ga0466967_0037864 Ga0466967_0037864_940_1542 198
156 3300045976 Ga0466967_0040872 Ga0466967_0040872_1460_2083 198
157 3300045976 Ga0466967_0105798 Ga0466967_0105798_1382_1978 198
158 3300045976 Ga0466967_0178615 Ga0466967_0178615_766_1368 198
159 3300045976 Ga0466967_0337711 Ga0466967_0337711_230_835 198
160 3300045976 Ga0466967_0360539 Ga0466967_0360539_647_1318 198
161 3300045976 Ga0466967_0788615 Ga0466967_0788615_236_835 198
162 3300046539 Ga0495621_0169000 Ga0495621_0169000_29_637 198
163 3300048915 Ga0496112_0155595 Ga0496112_0155595_505_1119 198
164 3300050508 nmdc:mga09592_151122_c1 nmdc:mga09592_151122_c1_1081_1719 198
165 3300054114 Ga0501084_0327464 Ga0501084_0327464_139_744 198
166 3300061719 Ga0466962_0052472 Ga0466962_0052472_521_1126 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

47

219

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c0z-assembly1.cif.gz_A-2 the 1.6 a resolution crystal structure of novw: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of streptomyces spheroides 0.9867 2 190
4hn1-assembly1.cif.gz_B crystal structure of h60n/y130f double mutant of chmj, a 3'-monoepimerase from streptomyces bikiniensis in complex with dtdp 0.982 5 197
4hn0-assembly1.cif.gz_B crystal structure of chmj, a 3'-monoepimerase apoenzyme from streptomyces bikiniensis 0.9816 6 197
1upi-assembly1.cif.gz_A mycobacterium tuberculosis rmlc epimerase (rv3465) 0.9786 1 198
7pwh-assembly1.cif.gz_AAA structure of the dtdp-sugar epimerase strm 0.9758 2 197
ID Description Score Start End Superfamily
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9867 1 190 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.978 1 195 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9765 1 190 2.60.120.10
1ofnB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9723 1 197 2.60.120.10
1ofnB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9627 1 197 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A193CB63-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 1.001 1 197 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A6L5ES31-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 1 1 197 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7J9VZX6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 1 1 197 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A838S3D0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase family protein 1 1 197 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A6N7H2V8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9989 1 197 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
96.68 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map