F248293

General Info

Members Datasets Scaffolds Average Seq Length
166 94 166 127

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10470254|Ga0114129_104702544
Length 141
Sequence MTGRLIAGQIMQHEGSVSMTSWTKDEITKIGAEEELQIASRRRDGTLRKPVIIWVVRYGDDLYVRSVNGRTASWFRGTQVRHGGRIQAGGVDKDVTFVDASPDLNDQIDAVYRSKYRRYAASIINSIVSPTARSATIKLIP

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
51 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
64 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
65 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
80 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.2
Rhizosphere 98.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005654 3300003203 Bacteria 5782
2 JGI25406J46586_10088247 3300003203 Bacteria 939
3 Ga0065707_10367319 3300005295 Unclassified 895
4 Ga0070680_100540775 3300005336 Bacteria 998
5 Ga0070689_101308828 3300005340 Bacteria 653
6 Ga0070689_101770166 3300005340 Bacteria 563
7 Ga0070713_100238396 3300005436 Unclassified 1655
8 Ga0070711_100532831 3300005439 Bacteria 972
9 Ga0070705_100426862 3300005440 Unclassified 988
10 Ga0070700_100662631 3300005441 Bacteria 825
11 Ga0070708_100002975 3300005445 Bacteria 13171
12 Ga0070708_100005570 3300005445 Bacteria 9977
13 Ga0070708_100168027 3300005445 Bacteria 2047
14 Ga0070708_100498691 3300005445 Unclassified 1148
15 Ga0070681_11426140 3300005458 Bacteria 616
16 Ga0070706_100001685 3300005467 Bacteria 23030
17 Ga0070706_100391413 3300005467 Bacteria 1294
18 Ga0070706_100606772 3300005467 Bacteria 1017
19 Ga0070706_101294869 3300005467 Unclassified 668
20 Ga0070706_101825499 3300005467 Bacteria 552
21 Ga0070707_100053782 3300005468 Bacteria 3860
22 Ga0070707_100055999 3300005468 Bacteria 3781
23 Ga0070707_100679945 3300005468 Bacteria 992
24 Ga0070707_101532225 3300005468 Unclassified 633
25 Ga0070698_100001292 3300005471 Bacteria 27926
26 Ga0070698_100034006 3300005471 Bacteria 5281
27 Ga0070698_100080043 3300005471 Unclassified 3262
28 Ga0070698_100303109 3300005471 Unclassified 1528
29 Ga0070698_100394776 3300005471 Bacteria 1316
30 Ga0070698_100807589 3300005471 Bacteria 882
31 Ga0070698_101897264 3300005471 Unclassified 549
32 Ga0070699_100005635 3300005518 Bacteria 10977
33 Ga0070699_100075903 3300005518 Bacteria 2925
34 Ga0070699_100807313 3300005518 Bacteria 859
35 Ga0070699_101002036 3300005518 Unclassified 766
36 Ga0070697_100077743 3300005536 Bacteria 2730
37 Ga0070697_100698583 3300005536 Bacteria 895
38 Ga0070697_100749106 3300005536 Bacteria 863
39 Ga0070697_100905717 3300005536 Unclassified 782
40 Ga0070697_101870697 3300005536 Unclassified 537
41 Ga0070686_101391611 3300005544 Unclassified 588
42 Ga0070704_101347894 3300005549 Bacteria 654
43 Ga0068864_101080807 3300005618 Bacteria 798
44 Ga0068861_102447883 3300005719 Unclassified 525
45 Ga0081539_10002536 3300005985 Bacteria 25457
46 Ga0070717_10503414 3300006028 Bacteria 1095
47 Ga0070712_100990287 3300006175 Bacteria 727
48 Ga0070712_101644629 3300006175 Bacteria 562
49 Ga0075428_100171466 3300006844 Bacteria 2351
50 Ga0075428_100775004 3300006844 Bacteria 1020
51 Ga0075431_100191805 3300006847 Unclassified 2093
52 Ga0075431_101029133 3300006847 Unclassified 790
53 Ga0075433_10033876 3300006852 Bacteria 4382
54 Ga0075433_10211192 3300006852 Unclassified 1725
55 Ga0075434_100946255 3300006871 Unclassified 876
56 Ga0075429_100000945 3300006880 Bacteria 22997
57 Ga0075429_100095502 3300006880 Bacteria 2592
58 Ga0099795_10352151 3300007788 Unclassified 659
59 Ga0105251_10390663 3300009011 Unclassified 639
60 Ga0111539_10524537 3300009094 Unclassified 1380
61 Ga0105245_11189432 3300009098 Bacteria 810
62 Ga0114129_10025283 3300009147 Bacteria 8414
63 Ga0114129_10183768 3300009147 Bacteria 2843
64 Ga0114129_10313186 3300009147 Unclassified 2089
65 Ga0114129_10456283 3300009147 Bacteria 1675
66 Ga0114129_10470254 3300009147 Bacteria 1646
67 Ga0114129_10488848 3300009147 Bacteria 1609
68 Ga0114129_10504753 3300009147 Bacteria 1579
69 Ga0114129_11073091 3300009147 Bacteria 1010
70 Ga0105243_10946899 3300009148 Unclassified 860
71 Ga0105242_11019030 3300009176 Unclassified 837
72 Ga0163162_11043392 3300013306 Bacteria 925
73 Ga0157375_11595382 3300013308 Unclassified 771
74 Ga0163163_10421124 3300014325 Bacteria 1394
75 Ga0157380_10475571 3300014326 Bacteria 1207
76 Ga0206354_11671960 3300020081 Bacteria 1025
77 Ga0207684_10000553 3300025910 Bacteria 46035
78 Ga0207684_10001043 3300025910 Bacteria 30980
79 Ga0207684_10007561 3300025910 Bacteria 9770
80 Ga0207684_10061213 3300025910 Bacteria 3197
81 Ga0207707_11197988 3300025912 Bacteria 615
82 Ga0207646_10002883 3300025922 Bacteria 19953
83 Ga0207646_10071103 3300025922 Bacteria 3107
84 Ga0207646_10074826 3300025922 Unclassified 3025
85 Ga0207646_10100018 3300025922 Bacteria 2599
86 Ga0207646_10163270 3300025922 Bacteria 2011
87 Ga0207668_11666391 3300025972 Bacteria 576
88 Ga0207708_10010121 3300026075 Bacteria 7002
89 Ga0207675_101277729 3300026118 Unclassified 754
90 Ga0207428_10343917 3300027907 Bacteria 1098
91 Ga0265338_10157066 3300028800 Bacteria 1761
92 Ga0265324_10032881 3300029957 Bacteria 1812
93 Ga0265320_10058819 3300031240 Bacteria 1839
94 Ga0316575_10048838 3300031665 Unclassified 1683
95 Ga0316579_10007367 3300031691 Bacteria 4542
96 Ga0316579_10064216 3300031691 Bacteria 1731
97 Ga0316579_10402444 3300031691 Unclassified 662
98 Ga0265314_10148590 3300031711 Bacteria 1440
99 Ga0316576_10001331 3300031727 Bacteria 13126
100 Ga0316576_10075842 3300031727 Bacteria 2487
101 Ga0316578_10004135 3300031728 Bacteria 6794
102 Ga0316578_10006231 3300031728 Bacteria 5865
103 Ga0316577_10034627 3300031733 Bacteria 2821
104 Ga0307410_10434644 3300031852 Bacteria 1067
105 Ga0307406_10238425 3300031901 Bacteria 1363
106 Ga0307406_10407259 3300031901 Bacteria 1080
107 Ga0307412_10049955 3300031911 Bacteria 2758
108 Ga0307409_100070035 3300031995 Bacteria 2782
109 Ga0307409_100744948 3300031995 Bacteria 983
110 Ga0307416_100219846 3300032002 Bacteria 1820
111 Ga0307416_100290683 3300032002 Bacteria 1618
112 Ga0307414_10465506 3300032004 Bacteria 1112
113 Ga0307415_100124572 3300032126 Bacteria 1939
114 Ga0316583_10012209 3300032133 Bacteria 3099
115 Ga0316583_10235893 3300032133 Unclassified 634
116 Ga0316585_10012443 3300032137 Bacteria 2521
117 Ga0316585_10107176 3300032137 Unclassified 918
118 Ga0316585_10213134 3300032137 Bacteria 639
119 Ga0316580_10000288 3300032139 Bacteria 10875
120 Ga0316574_0004248 3300035398 Bacteria 7481
121 Ga0316574_0065223 3300035398 Bacteria 2292
122 Ga0373933_0943246 3300035724 Bacteria 568
123 Ga0373937_1415226 3300036401 Bacteria 643
124 Ga0316582_0018494 3300036647 Bacteria 4057
125 Ga0316582_0036278 3300036647 Bacteria 3050
126 Ga0316582_0043874 3300036647 Bacteria 2808
127 Ga0316584_0036044 3300036712 Bacteria 3670
128 Ga0316584_0074053 3300036712 Bacteria 2553
129 Ga0316584_0091090 3300036712 Bacteria 2283
130 Ga0316581_0001342 3300037588 Bacteria 5471
131 Ga0453683_0179483 3300044673 Bacteria 1343
132 Ga0453684_0145664 3300044712 Bacteria 2822
133 Ga0453684_0292124 3300044712 Bacteria 1856
134 Ga0453684_0341504 3300044712 Bacteria 1690
135 Ga0453684_0873078 3300044712 Bacteria 965
136 Ga0451576_0030539 3300045051 Bacteria 5757
137 Ga0451576_0493987 3300045051 Bacteria 1286
138 Ga0495640_0956311 3300046533 Bacteria 506
139 Ga0495635_0331881 3300046663 Bacteria 1017
140 Ga0495657_0740806 3300046675 Bacteria 564
141 Ga0495674_0662891 3300047319 Bacteria 822
142 Ga0495684_0211004 3300047471 Bacteria 1428
143 Ga0496112_0610558 3300048915 Bacteria 1022
144 Ga0496115_1002909 3300048918 Unclassified 638
145 Ga0501031_0585911 3300049568 Unclassified 718
146 Ga0501034_0163066 3300049571 Unclassified 2199
147 Ga0501037_0007447 3300049573 Bacteria 8006
148 Ga0501038_0126707 3300049574 Bacteria 2101
149 Ga0501081_0033384 3300049743 Bacteria 3496
150 Ga0501044_0002234 3300049823 Bacteria 22166
151 Ga0501045_0360497 3300049824 Bacteria 1082
152 Ga0501045_0453863 3300049824 Bacteria 953
153 nmdc:mga05p37_10828_c1 3300050507 Bacteria 10830
154 nmdc:mga05p37_461_c1 3300050507 Bacteria 44218
155 nmdc:mga05p37_521064_c1 3300050507 Bacteria 1360
156 nmdc:mga05p37_548855_c1 3300050507 Unclassified 1316
157 nmdc:mga05p37_86169_c1 3300050507 Bacteria 3871
158 nmdc:mga09592_2481_c2 3300050508 Bacteria 9471
159 nmdc:mga09592_369062_c1 3300050508 Bacteria 1241
160 nmdc:mga06r32_403642_c1 3300050510 Unclassified 1349
161 nmdc:mga0n895_1365022_c1 3300050512 Unclassified 678
162 nmdc:mga0n895_175114_c1 3300050512 Bacteria 2176
163 nmdc:mga0a205_19522_c1 3300050515 Bacteria 6392
164 nmdc:mga0a205_217792_c1 3300050515 Unclassified 1796
165 nmdc:mga0a205_754738_c1 3300050515 Bacteria 821
166 Ga0495595_0710933 3300053084 Bacteria 515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10504753 Ga0114129_105047531 113
2 3300026118 Ga0207675_101277729 Ga0207675_1012777292 118
3 3300009147 Ga0114129_11073091 Ga0114129_110730912 120
4 3300005445 Ga0070708_100168027 Ga0070708_1001680272 122
5 3300005471 Ga0070698_100394776 Ga0070698_1003947764 122
6 3300005518 Ga0070699_100807313 Ga0070699_1008073132 122
7 3300005536 Ga0070697_100905717 Ga0070697_1009057172 122
8 3300025910 Ga0207684_10061213 Ga0207684_100612132 122
9 3300048918 Ga0496115_1002909 Ga0496115_1002909_28_396 122
10 3300005336 Ga0070680_100540775 Ga0070680_1005407752 123
11 3300005439 Ga0070711_100532831 Ga0070711_1005328312 123
12 3300005445 Ga0070708_100002975 Ga0070708_10000297512 123
13 3300005458 Ga0070681_11426140 Ga0070681_114261402 123
14 3300005467 Ga0070706_100001685 Ga0070706_10000168522 123
15 3300005467 Ga0070706_101825499 Ga0070706_1018254991 123
16 3300005471 Ga0070698_100080043 Ga0070698_1000800433 123
17 3300006175 Ga0070712_101644629 Ga0070712_1016446292 123
18 3300006871 Ga0075434_100946255 Ga0075434_1009462552 123
19 3300009147 Ga0114129_10470254 Ga0114129_104702544 123
20 3300025910 Ga0207684_10001043 Ga0207684_1000104322 123
21 3300025912 Ga0207707_11197988 Ga0207707_111979882 123
22 3300025922 Ga0207646_10074826 Ga0207646_100748264 123
23 3300031665 Ga0316575_10048838 Ga0316575_100488382 123
24 3300031691 Ga0316579_10007367 Ga0316579_100073672 123
25 3300031691 Ga0316579_10402444 Ga0316579_104024441 123
26 3300031727 Ga0316576_10001331 Ga0316576_100013315 123
27 3300031727 Ga0316576_10075842 Ga0316576_100758422 123
28 3300031728 Ga0316578_10004135 Ga0316578_100041354 123
29 3300031728 Ga0316578_10006231 Ga0316578_100062312 123
30 3300031733 Ga0316577_10034627 Ga0316577_100346272 123
31 3300031852 Ga0307410_10434644 Ga0307410_104346442 123
32 3300031901 Ga0307406_10407259 Ga0307406_104072592 123
33 3300031911 Ga0307412_10049955 Ga0307412_100499551 123
34 3300031995 Ga0307409_100070035 Ga0307409_1000700352 123
35 3300031995 Ga0307409_100744948 Ga0307409_1007449482 123
36 3300032002 Ga0307416_100219846 Ga0307416_1002198462 123
37 3300032004 Ga0307414_10465506 Ga0307414_104655062 123
38 3300032126 Ga0307415_100124572 Ga0307415_1001245722 123
39 3300032133 Ga0316583_10012209 Ga0316583_100122092 123
40 3300032133 Ga0316583_10235893 Ga0316583_102358931 123
41 3300032137 Ga0316585_10012443 Ga0316585_100124432 123
42 3300032139 Ga0316580_10000288 Ga0316580_100002883 123
43 3300035398 Ga0316574_0004248 Ga0316574_0004248_4612_4995 123
44 3300035398 Ga0316574_0065223 Ga0316574_0065223_1046_1429 123
45 3300035724 Ga0373933_0943246 Ga0373933_0943246_153_524 123
46 3300036401 Ga0373937_1415226 Ga0373937_1415226_128_499 123
47 3300036647 Ga0316582_0018494 Ga0316582_0018494_2112_2495 123
48 3300036647 Ga0316582_0043874 Ga0316582_0043874_1128_1511 123
49 3300036712 Ga0316584_0036044 Ga0316584_0036044_861_1244 123
50 3300037588 Ga0316581_0001342 Ga0316581_0001342_2183_2566 123
51 3300047319 Ga0495674_0662891 Ga0495674_0662891_15_398 123
52 3300048915 Ga0496112_0610558 Ga0496112_0610558_268_639 123
53 3300050508 nmdc:mga09592_369062_c1 nmdc:mga09592_369062_c1_95_466 123
54 3300053084 Ga0495595_0710933 Ga0495595_0710933_52_423 123
55 3300003203 JGI25406J46586_10088247 JGI25406J46586_100882472 124
56 3300005295 Ga0065707_10367319 Ga0065707_103673192 124
57 3300005340 Ga0070689_101308828 Ga0070689_1013088282 124
58 3300005340 Ga0070689_101770166 Ga0070689_1017701661 124
59 3300005436 Ga0070713_100238396 Ga0070713_1002383961 124
60 3300005445 Ga0070708_100005570 Ga0070708_1000055708 124
61 3300005468 Ga0070707_100055999 Ga0070707_1000559994 124
62 3300005471 Ga0070698_100001292 Ga0070698_10000129216 124
63 3300005471 Ga0070698_100034006 Ga0070698_1000340062 124
64 3300005471 Ga0070698_100807589 Ga0070698_1008075891 124
65 3300005471 Ga0070698_101897264 Ga0070698_1018972641 124
66 3300005518 Ga0070699_100005635 Ga0070699_10000563510 124
67 3300005536 Ga0070697_100698583 Ga0070697_1006985831 124
68 3300005536 Ga0070697_100749106 Ga0070697_1007491062 124
69 3300005544 Ga0070686_101391611 Ga0070686_1013916111 124
70 3300005549 Ga0070704_101347894 Ga0070704_1013478942 124
71 3300005618 Ga0068864_101080807 Ga0068864_1010808072 124
72 3300005719 Ga0068861_102447883 Ga0068861_1024478831 124
73 3300005985 Ga0081539_10002536 Ga0081539_100025366 124
74 3300006028 Ga0070717_10503414 Ga0070717_105034141 124
75 3300006175 Ga0070712_100990287 Ga0070712_1009902872 124
76 3300006852 Ga0075433_10033876 Ga0075433_100338764 124
77 3300009094 Ga0111539_10524537 Ga0111539_105245372 124
78 3300009098 Ga0105245_11189432 Ga0105245_111894322 124
79 3300013306 Ga0163162_11043392 Ga0163162_110433922 124
80 3300013308 Ga0157375_11595382 Ga0157375_115953821 124
81 3300020081 Ga0206354_11671960 Ga0206354_116719601 124
82 3300025910 Ga0207684_10000553 Ga0207684_1000055317 124
83 3300025922 Ga0207646_10071103 Ga0207646_100711032 124
84 3300025972 Ga0207668_11666391 Ga0207668_116663912 124
85 3300026075 Ga0207708_10010121 Ga0207708_100101218 124
86 3300027907 Ga0207428_10343917 Ga0207428_103439172 124
87 3300029957 Ga0265324_10032881 Ga0265324_100328812 124
88 3300031691 Ga0316579_10064216 Ga0316579_100642163 124
89 3300031711 Ga0265314_10148590 Ga0265314_101485902 124
90 3300031901 Ga0307406_10238425 Ga0307406_102384252 124
91 3300032002 Ga0307416_100290683 Ga0307416_1002906832 124
92 3300032137 Ga0316585_10107176 Ga0316585_101071762 124
93 3300032137 Ga0316585_10213134 Ga0316585_102131342 124
94 3300036647 Ga0316582_0036278 Ga0316582_0036278_2292_2675 124
95 3300036712 Ga0316584_0074053 Ga0316584_0074053_562_936 124
96 3300036712 Ga0316584_0091090 Ga0316584_0091090_344_727 124
97 3300044673 Ga0453683_0179483 Ga0453683_0179483_376_762 124
98 3300044712 Ga0453684_0145664 Ga0453684_0145664_554_940 124
99 3300044712 Ga0453684_0292124 Ga0453684_0292124_772_1146 124
100 3300044712 Ga0453684_0341504 Ga0453684_0341504_661_1035 124
101 3300046533 Ga0495640_0956311 Ga0495640_0956311_65_439 124
102 3300046663 Ga0495635_0331881 Ga0495635_0331881_577_951 124
103 3300046675 Ga0495657_0740806 Ga0495657_0740806_147_521 124
104 3300047471 Ga0495684_0211004 Ga0495684_0211004_821_1195 124
105 3300049568 Ga0501031_0585911 Ga0501031_0585911_95_469 124
106 3300050512 nmdc:mga0n895_1365022_c1 nmdc:mga0n895_1365022_c1_81_467 124
107 3300050515 nmdc:mga0a205_19522_c1 nmdc:mga0a205_19522_c1_4417_4800 124
108 3300003203 JGI25406J46586_10005654 JGI25406J46586_100056549 125
109 3300005440 Ga0070705_100426862 Ga0070705_1004268622 125
110 3300005441 Ga0070700_100662631 Ga0070700_1006626312 125
111 3300005445 Ga0070708_100498691 Ga0070708_1004986912 125
112 3300005467 Ga0070706_100391413 Ga0070706_1003914132 125
113 3300005467 Ga0070706_100606772 Ga0070706_1006067721 125
114 3300005467 Ga0070706_101294869 Ga0070706_1012948691 125
115 3300005468 Ga0070707_100053782 Ga0070707_1000537823 125
116 3300005468 Ga0070707_100679945 Ga0070707_1006799451 125
117 3300005468 Ga0070707_101532225 Ga0070707_1015322251 125
118 3300005471 Ga0070698_100303109 Ga0070698_1003031092 125
119 3300005518 Ga0070699_100075903 Ga0070699_1000759032 125
120 3300005518 Ga0070699_101002036 Ga0070699_1010020361 125
121 3300005536 Ga0070697_100077743 Ga0070697_1000777434 125
122 3300005536 Ga0070697_101870697 Ga0070697_1018706971 125
123 3300006844 Ga0075428_100171466 Ga0075428_1001714663 125
124 3300006844 Ga0075428_100775004 Ga0075428_1007750041 125
125 3300006847 Ga0075431_100191805 Ga0075431_1001918052 125
126 3300006847 Ga0075431_101029133 Ga0075431_1010291332 125
127 3300006852 Ga0075433_10211192 Ga0075433_102111922 125
128 3300006880 Ga0075429_100000945 Ga0075429_10000094527 125
129 3300006880 Ga0075429_100095502 Ga0075429_1000955022 125
130 3300007788 Ga0099795_10352151 Ga0099795_103521511 125
131 3300009011 Ga0105251_10390663 Ga0105251_103906631 125
132 3300009147 Ga0114129_10025283 Ga0114129_100252834 125
133 3300009147 Ga0114129_10183768 Ga0114129_101837684 125
134 3300009147 Ga0114129_10313186 Ga0114129_103131863 125
135 3300009147 Ga0114129_10456283 Ga0114129_104562832 125
136 3300009147 Ga0114129_10488848 Ga0114129_104888482 125
137 3300009148 Ga0105243_10946899 Ga0105243_109468992 125
138 3300009176 Ga0105242_11019030 Ga0105242_110190302 125
139 3300014325 Ga0163163_10421124 Ga0163163_104211241 125
140 3300014326 Ga0157380_10475571 Ga0157380_104755712 125
141 3300025910 Ga0207684_10007561 Ga0207684_100075612 125
142 3300025922 Ga0207646_10002883 Ga0207646_1000288320 125
143 3300025922 Ga0207646_10100018 Ga0207646_101000182 125
144 3300025922 Ga0207646_10163270 Ga0207646_101632703 125
145 3300028800 Ga0265338_10157066 Ga0265338_101570661 125
146 3300031240 Ga0265320_10058819 Ga0265320_100588192 125
147 3300044712 Ga0453684_0873078 Ga0453684_0873078_173_550 125
148 3300045051 Ga0451576_0030539 Ga0451576_0030539_1424_1807 125
149 3300045051 Ga0451576_0493987 Ga0451576_0493987_387_764 125
150 3300049571 Ga0501034_0163066 Ga0501034_0163066_260_643 125
151 3300049573 Ga0501037_0007447 Ga0501037_0007447_5096_5479 125
152 3300049574 Ga0501038_0126707 Ga0501038_0126707_60_443 125
153 3300049743 Ga0501081_0033384 Ga0501081_0033384_2480_2857 125
154 3300049823 Ga0501044_0002234 Ga0501044_0002234_9590_9973 125
155 3300049824 Ga0501045_0360497 Ga0501045_0360497_25_402 125
156 3300049824 Ga0501045_0453863 Ga0501045_0453863_152_535 125
157 3300050507 nmdc:mga05p37_10828_c1 nmdc:mga05p37_10828_c1_9458_9865 125
158 3300050507 nmdc:mga05p37_461_c1 nmdc:mga05p37_461_c1_35176_35565 125
159 3300050507 nmdc:mga05p37_521064_c1 nmdc:mga05p37_521064_c1_579_959 125
160 3300050507 nmdc:mga05p37_548855_c1 nmdc:mga05p37_548855_c1_708_1088 125
161 3300050507 nmdc:mga05p37_86169_c1 nmdc:mga05p37_86169_c1_2569_2964 125
162 3300050508 nmdc:mga09592_2481_c2 nmdc:mga09592_2481_c2_376_765 125
163 3300050510 nmdc:mga06r32_403642_c1 nmdc:mga06r32_403642_c1_104_481 125
164 3300050512 nmdc:mga0n895_175114_c1 nmdc:mga0n895_175114_c1_497_877 125
165 3300050515 nmdc:mga0a205_217792_c1 nmdc:mga0a205_217792_c1_945_1325 125
166 3300050515 nmdc:mga0a205_754738_c1 nmdc:mga0a205_754738_c1_313_720 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10012

DUF2255

Uncharacterized protein conserved in bacteria (DUF2255)

26

139

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wv4-assembly1.cif.gz_B x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.7576 16 86
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.7329 15 123
1vl7-assembly1.cif.gz_B crystal structure of a putative heme oxygenase (alr5027) from nostoc sp. pcc 7120 at 1.50 a resolution 0.7253 10 124
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.7204 15 123
3r5z-assembly2.cif.gz_B structure of a deazaflavin-dependent reductase from nocardia farcinica, with co-factor f420 0.7193 15 124
ID Description Score Start End Superfamily
1wv4B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7576 16 86 2.30.110.10
af_Q2FVN7_2_129_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7338 10 124 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7335 15 124 2.30.110.10
3gasD02 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7293 7 124 2.30.110.10
1vl7B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7253 10 124 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A259SJX3-F1-model_v4 DUF2255 domain-containing protein 0.9825 1 124
AF-A0A0P9FBQ6-F1-model_v4 DUF2255 family protein 0.9811 1 124
AF-A0A371Y7S3-F1-model_v4 DUF2255 family protein 0.9753 1 124
AF-A0A535J714-F1-model_v4 DUF2255 family protein 0.9748 1 124
AF-A0A259SJX3-F1-model_v4 DUF2255 domain-containing protein 0.9748 1 124

Feature Viewer

pLDDT pTM Quality
96.67 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map