F246721

General Info

Members Datasets Scaffolds Average Seq Length
165 137 330 185

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0404299|Ga0451855_0404299_50_679
Length 209
Sequence MPSAVGYQPTLASEMGTMQERITSTKTGSITSVQAVYVPADDLTDPAPATTFTHLDATTELSRNIAQLGIYPAVDPLGSTSRILDPLVVGQEHYDCAQRVKQILQKYMELQDIIAILGMDELSDEXXDEDKLTVNRARRVQRFLSQPFAVAEQFTGVKGEMVSIEDTIKGFNMILNGELDDLPEQAFLNVGTIEQAIEKGKKLLAQAQG

Samples

Sample ID Description Type Environment
1 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
4 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
5 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
6 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
7 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
8 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
9 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
10 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
11 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
12 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
13 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
14 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
15 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
16 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
17 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
18 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
19 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
20 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
21 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
22 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
23 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
24 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
25 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
26 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
27 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
28 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
29 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
30 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
31 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
32 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
33 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
34 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
35 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
36 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
37 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
38 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
39 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
40 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
41 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
42 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
43 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
44 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
45 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
46 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
49 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
50 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
51 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
52 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
53 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
54 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
55 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
56 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
57 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
58 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
59 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
60 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
61 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
62 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
63 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
64 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
65 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
66 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
67 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
68 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
69 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
72 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
73 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
74 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
75 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
76 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
77 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
82 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
83 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
84 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
87 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
93 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
94 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
117 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
118 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
132 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
135 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
136 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.09
Metatranscriptomes 10.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 0
Rhizoplane 6.67
Rhizosphere 80.61
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451855_0404299 3300041511 Bacteria 708
2 Ga0070690_100557613 3300005330 Bacteria 864
3 Ga0075366_10127987 3300006195 Bacteria 1532
4 Ga0105243_11533503 3300009148 Bacteria 691
5 Ga0157378_10137133 3300013297 Bacteria 2269
6 Ga0157378_10199461 3300013297 Bacteria 1892
7 Ga0157372_10435159 3300013307 Bacteria 1529
8 Ga0182005_1164396 3300015265 Bacteria 652
9 Ga0209995_1014358 3300027471 Bacteria 1299
10 Ga0373930_0010244 3300034816 Bacteria 1672
11 Ga0373938_0055973 3300034957 Bacteria 912
12 Ga0373926_0018834 3300035083 Bacteria 2378
13 Ga0373952_0169601 3300035092 Bacteria 623
14 Ga0373923_0003538 3300035111 Bacteria 5024
15 Ga0373939_0285912 3300035114 Bacteria 653
16 Ga0373945_0114982 3300035116 Bacteria 1065
17 Ga0373945_0369424 3300035116 Bacteria 625
18 Ga0373954_0253366 3300035118 Bacteria 867
19 Ga0373960_0012192 3300035121 Bacteria 2132
20 Ga0373942_0229483 3300035207 Bacteria 625
21 Ga0373961_0053393 3300035241 Bacteria 1206
22 Ga0373931_0008543 3300035691 Bacteria 4861
23 Ga0373931_0611715 3300035691 Bacteria 713
24 Ga0373947_0482856 3300035725 Bacteria 841
25 Ga0316584_0699037 3300036712 Eukaryota 695
26 Ga0316584_0799937 3300036712 Bacteria 640
27 Ga0373925_1155398 3300037068 Bacteria 637
28 Ga0395900_0409796 3300037418 Bacteria 1318
29 Ga0395905_0242115 3300037471 Bacteria 1685
30 Ga0436364_0223931 3300037853 Bacteria 4958
31 Ga0242420_116631 3300038996 Bacteria 579
32 Ga0400483_020139 3300039062 Bacteria 2498
33 Ga0436365_0917468 3300039437 Bacteria 922
34 Ga0436361_0408047 3300039447 Bacteria 992
35 Ga0436361_0876307 3300039447 Bacteria 874
36 Ga0436363_1395288 3300039450 Bacteria 868
37 Ga0439465_0043187 3300041413 Bacteria 1463
38 Ga0451793_1736042 3300041452 Bacteria 1315
39 Ga0451805_060311 3300041461 Bacteria 1169
40 Ga0451833_0611110 3300041491 Bacteria 670
41 Ga0451837_1647632 3300041494 Bacteria 560
42 Ga0451843_0066593 3300041509 Bacteria 968
43 Ga0451853_2598354 3300041512 Bacteria 643
44 Ga0439431_0159196 3300041997 Bacteria 645
45 Ga0439445_0124395 3300042004 Bacteria 741
46 Ga0439454_009995 3300042011 Bacteria 1243
47 Ga0439462_0099097 3300042015 Bacteria 802
48 Ga0450895_000980 3300042132 Bacteria 1864
49 Ga0450893_0007353 3300042532 Bacteria 1789
50 Ga0451577_0098514 3300042876 Bacteria 2611
51 Ga0453683_0290421 3300044673 Bacteria 1045
52 Ga0453683_0495642 3300044673 Bacteria 792
53 Ga0453683_0654307 3300044673 Bacteria 687
54 Ga0466966_0611886 3300044684 Bacteria 656
55 Ga0466964_0304291 3300044706 Bacteria 805
56 Ga0453684_0217006 3300044712 Bacteria 2219
57 Ga0453684_1610446 3300044712 Bacteria 666
58 Ga0466968_0279127 3300044735 Bacteria 799
59 Ga0466959_0156254 3300045049 Bacteria 1605
60 Ga0466959_0650743 3300045049 Bacteria 707
61 Ga0451576_0023440 3300045051 Bacteria 6682
62 Ga0451576_0351046 3300045051 Bacteria 1544
63 Ga0451576_1073967 3300045051 Bacteria 843
64 Ga0466958_0974254 3300045836 Bacteria 553
65 Ga0495653_0547514 3300046463 Bacteria 716
66 Ga0495583_0200149 3300046506 Bacteria 812
67 Ga0495618_0489307 3300046514 Bacteria 743
68 Ga0495628_0305947 3300046516 Bacteria 1176
69 Ga0495630_0380428 3300046517 Bacteria 1081
70 Ga0495642_0136879 3300046528 Bacteria 1056
71 Ga0495652_0169239 3300046529 Bacteria 1688
72 Ga0495665_0564288 3300046531 Bacteria 571
73 Ga0495586_0119583 3300046535 Bacteria 1471
74 Ga0495586_0195543 3300046535 Bacteria 1146
75 Ga0495587_0508796 3300046536 Bacteria 666
76 Ga0495622_0014512 3300046557 Bacteria 3659
77 Ga0495634_0633151 3300046642 Bacteria 619
78 Ga0495659_0300962 3300046664 Bacteria 678
79 Ga0495657_0186965 3300046675 Bacteria 1268
80 Ga0495623_0272889 3300046679 Bacteria 944
81 Ga0495658_0366596 3300046683 Bacteria 916
82 Ga0495613_0300279 3300046689 Bacteria 1112
83 Ga0495624_0731416 3300046690 Bacteria 587
84 Ga0495671_0269949 3300046692 Bacteria 820
85 Ga0495649_0300841 3300046694 Bacteria 817
86 Ga0495581_0649005 3300047315 Unclassified 610
87 Ga0495604_0053300 3300047317 Bacteria 3127
88 Ga0495604_0125597 3300047317 Bacteria 1850
89 Ga0495636_0000197 3300047318 Bacteria 23863
90 Ga0495675_0652446 3300047444 Bacteria 593
91 Ga0496101_0630491 3300048904 Bacteria 847
92 Ga0496101_1182716 3300048904 Bacteria 599
93 Ga0496102_0524581 3300048905 Bacteria 1107
94 Ga0496104_0343576 3300048907 Bacteria 1405
95 Ga0496107_0596140 3300048910 Bacteria 817
96 Ga0496110_1168482 3300048913 Bacteria 678
97 Ga0496111_0303670 3300048914 Bacteria 1183
98 Ga0496112_1098524 3300048915 Bacteria 714
99 Ga0496115_0876155 3300048918 Bacteria 694
100 Ga0496116_0014875 3300048919 Bacteria 6181
101 Ga0496123_0355024 3300048926 Bacteria 680
102 Ga0496126_0899116 3300048929 Bacteria 671
103 Ga0501306_009428 3300049127 Bacteria 1212
104 Ga0501306_040609 3300049127 Bacteria 721
105 Ga0501306_042512 3300049127 Bacteria 708
106 Ga0501308_029082 3300049128 Bacteria 733
107 Ga0501343_007590 3300049132 Bacteria 858
108 Ga0495682_0003863 3300049460 Bacteria 6566
109 Ga0501298_039266 3300049521 Bacteria 955
110 Ga0501298_117447 3300049521 Bacteria 623
111 Ga0501313_029939 3300049529 Bacteria 703
112 Ga0501316_028601 3300049532 Bacteria 737
113 Ga0501316_031997 3300049532 Bacteria 707
114 Ga0501317_047403 3300049533 Bacteria 674
115 Ga0501318_012110 3300049534 Bacteria 984
116 Ga0501324_023809 3300049540 Bacteria 639
117 Ga0501328_03475 3300049544 Bacteria 732
118 Ga0501328_04620 3300049544 Bacteria 674
119 Ga0501332_12191 3300049548 Bacteria 589
120 Ga0501333_006475 3300049549 Bacteria 780
121 Ga0501336_007418 3300049552 Bacteria 832
122 Ga0501338_02562 3300049554 Bacteria 1039
123 Ga0501032_0403602 3300049569 Bacteria 878
124 Ga0501032_0754283 3300049569 Bacteria 616
125 Ga0501032_0847741 3300049569 Bacteria 576
126 Ga0501039_1153937 3300049575 Bacteria 600
127 Ga0501043_0319690 3300049579 Bacteria 1183
128 Ga0501046_0319337 3300049580 Bacteria 1132
129 Ga0501048_0176067 3300049582 Bacteria 1516
130 Ga0501048_0455602 3300049582 Bacteria 916
131 Ga0501048_0713194 3300049582 Bacteria 720
132 Ga0501048_1038393 3300049582 Bacteria 589
133 Ga0501067_0335246 3300049583 Bacteria 843
134 Ga0501068_0173364 3300049584 Bacteria 1362
135 Ga0501068_0427015 3300049584 Bacteria 856
136 Ga0501071_0285590 3300049587 Bacteria 1249
137 Ga0501072_0403679 3300049588 Bacteria 1084
138 Ga0501074_0260245 3300049590 Bacteria 1234
139 Ga0501075_0614525 3300049591 Bacteria 829
140 Ga0501076_0420505 3300049592 Bacteria 1100
141 Ga0501238_024767 3300049671 Bacteria 858
142 Ga0501242_023469 3300049674 Bacteria 805
143 Ga0501249_092419 3300049679 Bacteria 719
144 Ga0501080_0966551 3300049742 Bacteria 740
145 Ga0501083_0718264 3300049744 Bacteria 650
146 Ga0501044_1151478 3300049823 Bacteria 644
147 nmdc:mga0k408_370045_c1 3300050493 Bacteria 854
148 nmdc:mga05p37_134718_c1 3300050507 Bacteria 3030
149 nmdc:mga09592_1103787_c1 3300050508 Bacteria 659
150 nmdc:mga09592_521003_c1 3300050508 Bacteria 1022
151 nmdc:mga08y16_338954_c1 3300050511 Bacteria 1546
152 nmdc:mga0n895_1542603_c1 3300050512 Bacteria 630
153 nmdc:mga0rr50_108616_c1 3300050513 Bacteria 2192
154 nmdc:mga0a205_351958_c1 3300050515 Bacteria 1340
155 nmdc:mga0sz30_309100_c1 3300050516 Bacteria 705
156 Ga0495601_0321636 3300053077 Bacteria 1007
157 Ga0500651_0348471 3300053093 Bacteria 841
158 Ga0500564_341000 3300053138 Bacteria 561
159 Ga0500568_0027380 3300053139 Bacteria 2384
160 Ga0500577_0448439 3300053142 Bacteria 564
161 Ga0500588_0125139 3300053146 Bacteria 910
162 Ga0500627_0403589 3300053158 Bacteria 582
163 Ga0501084_0144213 3300054114 Bacteria 2006
164 Ga0501084_0210346 3300054114 Bacteria 1641
165 Ga0501084_0371369 3300054114 Bacteria 1209
166 Ga0451855_0404299
167 Ga0070690_100557613
168 Ga0075366_10127987
169 Ga0105243_11533503
170 Ga0157378_10137133
171 Ga0157378_10199461
172 Ga0157372_10435159
173 Ga0182005_1164396
174 Ga0209995_1014358
175 Ga0373930_0010244
176 Ga0373938_0055973
177 Ga0373926_0018834
178 Ga0373952_0169601
179 Ga0373923_0003538
180 Ga0373939_0285912
181 Ga0373945_0114982
182 Ga0373945_0369424
183 Ga0373954_0253366
184 Ga0373960_0012192
185 Ga0373942_0229483
186 Ga0373961_0053393
187 Ga0373931_0008543
188 Ga0373931_0611715
189 Ga0373947_0482856
190 Ga0316584_0699037
191 Ga0316584_0799937
192 Ga0373925_1155398
193 Ga0395900_0409796
194 Ga0395905_0242115
195 Ga0436364_0223931
196 Ga0242420_116631
197 Ga0400483_020139
198 Ga0436365_0917468
199 Ga0436361_0408047
200 Ga0436361_0876307
201 Ga0436363_1395288
202 Ga0439465_0043187
203 Ga0451793_1736042
204 Ga0451805_060311
205 Ga0451833_0611110
206 Ga0451837_1647632
207 Ga0451843_0066593
208 Ga0451853_2598354
209 Ga0439431_0159196
210 Ga0439445_0124395
211 Ga0439454_009995
212 Ga0439462_0099097
213 Ga0450895_000980
214 Ga0450893_0007353
215 Ga0451577_0098514
216 Ga0453683_0290421
217 Ga0453683_0495642
218 Ga0453683_0654307
219 Ga0466966_0611886
220 Ga0466964_0304291
221 Ga0453684_0217006
222 Ga0453684_1610446
223 Ga0466968_0279127
224 Ga0466959_0156254
225 Ga0466959_0650743
226 Ga0451576_0023440
227 Ga0451576_0351046
228 Ga0451576_1073967
229 Ga0466958_0974254
230 Ga0495653_0547514
231 Ga0495583_0200149
232 Ga0495618_0489307
233 Ga0495628_0305947
234 Ga0495630_0380428
235 Ga0495642_0136879
236 Ga0495652_0169239
237 Ga0495665_0564288
238 Ga0495586_0119583
239 Ga0495586_0195543
240 Ga0495587_0508796
241 Ga0495622_0014512
242 Ga0495634_0633151
243 Ga0495659_0300962
244 Ga0495657_0186965
245 Ga0495623_0272889
246 Ga0495658_0366596
247 Ga0495613_0300279
248 Ga0495624_0731416
249 Ga0495671_0269949
250 Ga0495649_0300841
251 Ga0495581_0649005
252 Ga0495604_0053300
253 Ga0495604_0125597
254 Ga0495636_0000197
255 Ga0495675_0652446
256 Ga0496101_0630491
257 Ga0496101_1182716
258 Ga0496102_0524581
259 Ga0496104_0343576
260 Ga0496107_0596140
261 Ga0496110_1168482
262 Ga0496111_0303670
263 Ga0496112_1098524
264 Ga0496115_0876155
265 Ga0496116_0014875
266 Ga0496123_0355024
267 Ga0496126_0899116
268 Ga0501306_009428
269 Ga0501306_040609
270 Ga0501306_042512
271 Ga0501308_029082
272 Ga0501343_007590
273 Ga0495682_0003863
274 Ga0501298_039266
275 Ga0501298_117447
276 Ga0501313_029939
277 Ga0501316_028601
278 Ga0501316_031997
279 Ga0501317_047403
280 Ga0501318_012110
281 Ga0501324_023809
282 Ga0501328_03475
283 Ga0501328_04620
284 Ga0501332_12191
285 Ga0501333_006475
286 Ga0501336_007418
287 Ga0501338_02562
288 Ga0501032_0403602
289 Ga0501032_0754283
290 Ga0501032_0847741
291 Ga0501039_1153937
292 Ga0501043_0319690
293 Ga0501046_0319337
294 Ga0501048_0176067
295 Ga0501048_0455602
296 Ga0501048_0713194
297 Ga0501048_1038393
298 Ga0501067_0335246
299 Ga0501068_0173364
300 Ga0501068_0427015
301 Ga0501071_0285590
302 Ga0501072_0403679
303 Ga0501074_0260245
304 Ga0501075_0614525
305 Ga0501076_0420505
306 Ga0501238_024767
307 Ga0501242_023469
308 Ga0501249_092419
309 Ga0501080_0966551
310 Ga0501083_0718264
311 Ga0501044_1151478
312 nmdc:mga0k408_370045_c1
313 nmdc:mga05p37_134718_c1
314 nmdc:mga09592_1103787_c1
315 nmdc:mga09592_521003_c1
316 nmdc:mga08y16_338954_c1
317 nmdc:mga0n895_1542603_c1
318 nmdc:mga0rr50_108616_c1
319 nmdc:mga0a205_351958_c1
320 nmdc:mga0sz30_309100_c1
321 Ga0495601_0321636
322 Ga0500651_0348471
323 Ga0500564_341000
324 Ga0500568_0027380
325 Ga0500577_0448439
326 Ga0500588_0125139
327 Ga0500627_0403589
328 Ga0501084_0144213
329 Ga0501084_0210346
330 Ga0501084_0371369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00006

ATP-synt_ab

ATP synthase alpha/beta family, nucleotide-binding domain

1

81

0.98

PF22919

ATP-synt_VA_C

C-terminal domain of V and A type ATP synthase

84

183

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q4l-assembly1.cif.gz_A crystal structure of an atp synthase subunit beta 1 (f1-b1) from burkholderia thailandensis 0.9216 23 161
5cdf-assembly1.cif.gz_E structure at 2.3 a of the alpha/beta monomer of the f-atpase from paracoccus denitrificans 0.9169 21 161
8h9v-assembly1.cif.gz_D human atp synthase state 3b (combined) 0.8927 23 162
8h9p-assembly1.cif.gz_D human atp synthase f1 domain, state 3b 0.8922 23 162
6q45-assembly1.cif.gz_B f1-atpase from fusobacterium nucleatum 0.8692 27 146
ID Description Score Start End Superfamily
3ofnM03 Mainly Alpha;Orthogonal Bundle;Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3;Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 0.9124 48 154 1.10.1140.10
1h8eE03 Mainly Alpha;Orthogonal Bundle;Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3;Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 0.9079 48 151 1.10.1140.10
3oaaE03 Mainly Alpha;Orthogonal Bundle;Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3;Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 0.9003 49 161 1.10.1140.10
6cp3F03 Mainly Alpha;Orthogonal Bundle;Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3;Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 0.8999 48 167 1.10.1140.10
3ofnM03 Mainly Alpha;Orthogonal Bundle;Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3;Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 0.8889 48 154 1.10.1140.10
ID Description Score Start End GO Terms
AF-A0A067XS75-F1-model_v4 CF1 beta subunit of ATP synthase (EC 3.6.3.14) 0.9469 24 163 GO:0005524
GO:0005739
GO:0009507
GO:0016787
GO:0042776
GO:0045261
GO:0046933
AF-A0A351ARW7-F1-model_v4 F0F1 ATP synthase subunit beta 0.9455 24 167 GO:0005524
GO:0045261
GO:0046933
AF-A0A7Y2HHR4-F1-model_v4 F0F1 ATP synthase subunit beta 0.9434 22 166 GO:0005524
GO:0045261
GO:0046933
AF-A0A3C1RB99-F1-model_v4 F0F1 ATP synthase subunit beta 0.943 29 167 GO:0005524
GO:0045261
GO:0046933
AF-A0A0G1L8S6-F1-model_v4 ATP synthase subunit beta 0.9412 23 157 GO:0005524
GO:0045261
GO:0046933

Map