F246648

General Info

Members Datasets Scaffolds Average Seq Length
165 125 330 261

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0005503|Ga0395898_0005503_10530_11414
Length 294
Sequence MRGGLRYRFFPGFVRRLTRALLSEIVTAAHDNDVISPMTTPSPXXXLLEARDVQKHFGRVEALREANFTLRPDEVHAIVGDNGAGKSTLIKIISGVYQADAGEIAIDGQPVTIANPREARELGIETVYQDLALADHLDASGNLFLGREQLRPPPLSWFGFLDKKAMRRRAQEEMRRLKIGIQSVDQHVLSLSGGQRQAVAVARAIAWGTRIVIMDEPTAALGVRESSMVLELIKEVRSQGLAVIMVSHNLPEVFAVADRITVLRLGRTIVTLDKSETSLEDVVGMMTGALAVAA

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
27 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
40 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
41 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
47 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
48 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
54 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
59 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
73 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
76 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
77 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
97 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
98 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
99 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
100 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
101 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
102 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
103 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
104 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
105 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
106 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
107 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
108 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
109 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
110 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
111 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
112 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
113 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
114 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
115 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
116 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
117 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
118 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
119 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
120 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
121 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
122 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
123 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
124 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
125 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.58
Nodule 0
Rhizoplane 3.64
Rhizosphere 70.91
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0005503 3300037466 Bacteria 13672
2 Ga0070683_100400338 3300005329 Bacteria 1309
3 Ga0068869_100085561 3300005334 Bacteria 2362
4 Ga0070689_100224581 3300005340 Bacteria 1542
5 Ga0070687_100171255 3300005343 Bacteria 1292
6 Ga0070674_100197237 3300005356 Bacteria 1552
7 Ga0070713_100207410 3300005436 Bacteria 1773
8 Ga0070694_100203782 3300005444 Bacteria 1476
9 Ga0070708_100184001 3300005445 Bacteria 1953
10 Ga0070706_100015551 3300005467 Bacteria 7028
11 Ga0070707_100046199 3300005468 Bacteria 4167
12 Ga0070698_100095312 3300005471 Bacteria 2953
13 Ga0070679_100256715 3300005530 Bacteria 1703
14 Ga0068853_100006996 3300005539 Bacteria 9015
15 Ga0070696_100161279 3300005546 Bacteria 1652
16 Ga0068856_100018226 3300005614 Bacteria 6806
17 Ga0068864_100222717 3300005618 Bacteria 1741
18 Ga0070717_10004048 3300006028 Bacteria 10560
19 Ga0070717_10189297 3300006028 Bacteria 1797
20 Ga0070712_100033038 3300006175 Bacteria 3497
21 Ga0075434_100061625 3300006871 Bacteria 3733
22 Ga0075435_100362910 3300007076 Bacteria 1243
23 Ga0105243_10455456 3300009148 Bacteria 1201
24 Ga0157375_10193126 3300013308 Bacteria 2191
25 Ga0163163_10297997 3300014325 Bacteria 1665
26 Ga0157380_10189166 3300014326 Bacteria 1815
27 Ga0213872_10000055 3300021361 Bacteria 101489
28 Ga0207684_10056721 3300025910 Bacteria 3323
29 Ga0207693_10124734 3300025915 Bacteria 2023
30 Ga0207652_10212566 3300025921 Bacteria 1742
31 Ga0207646_10017223 3300025922 Bacteria 6768
32 Ga0207706_10759711 3300025933 Bacteria 826
33 Ga0207670_10116837 3300025936 Bacteria 1932
34 Ga0207639_10002114 3300026041 Bacteria 13387
35 Ga0207708_10141455 3300026075 Bacteria 1888
36 Ga0207702_10035775 3300026078 Bacteria 4152
37 Ga0207676_10149841 3300026095 Bacteria 2008
38 Ga0207675_100555545 3300026118 Bacteria 1148
39 Ga0268264_10302411 3300028381 Bacteria 1506
40 Ga0265336_10023258 3300028666 Bacteria 1967
41 Ga0307517_10062745 3300028786 Bacteria 3488
42 Ga0307517_10099905 3300028786 Bacteria 2296
43 Ga0307515_10012587 3300028794 Bacteria 15903
44 Ga0307515_10276089 3300028794 Bacteria 1394
45 Ga0265338_10000705 3300028800 Bacteria 57138
46 Ga0265338_10003496 3300028800 Bacteria 22044
47 Ga0265338_10042926 3300028800 Bacteria 4203
48 Ga0307512_10006805 3300030522 Bacteria 11477
49 Ga0265330_10032182 3300031235 Bacteria 2350
50 Ga0265330_10081213 3300031235 Bacteria 1397
51 Ga0265332_10014252 3300031238 Bacteria 3516
52 Ga0265332_10033116 3300031238 Bacteria 2250
53 Ga0265325_10002950 3300031241 Bacteria 11310
54 Ga0265340_10019850 3300031247 Bacteria 3458
55 Ga0265339_10005383 3300031249 Bacteria 8526
56 Ga0265339_10009500 3300031249 Bacteria 6111
57 Ga0265327_10008065 3300031251 Bacteria 7938
58 Ga0265316_10007733 3300031344 Bacteria 10073
59 Ga0265316_10107154 3300031344 Bacteria 2119
60 Ga0307513_10006742 3300031456 Bacteria 14980
61 Ga0307513_10009547 3300031456 Bacteria 12265
62 Ga0307509_10038283 3300031507 Bacteria 5234
63 Ga0265313_10010708 3300031595 Bacteria 5771
64 Ga0265313_10013553 3300031595 Bacteria 4883
65 Ga0265313_10019987 3300031595 Bacteria 3709
66 Ga0307508_10005139 3300031616 Bacteria 12529
67 Ga0307508_10023213 3300031616 Bacteria 5634
68 Ga0265314_10008844 3300031711 Bacteria 8598
69 Ga0265314_10026496 3300031711 Bacteria 4354
70 Ga0265314_10101987 3300031711 Bacteria 1842
71 Ga0265342_10070140 3300031712 Bacteria 2045
72 Ga0265342_10083149 3300031712 Bacteria 1846
73 Ga0265342_10136720 3300031712 Bacteria 1369
74 Ga0307516_10015073 3300031730 Bacteria 8147
75 Ga0373949_0000018 3300035090 Bacteria 59252
76 Ga0373941_0000853 3300035115 Bacteria 6291
77 Ga0373937_0062912 3300036401 Bacteria 3412
78 Ga0373925_0002693 3300037068 Bacteria 14096
79 Ga0395899_0014971 3300037312 Bacteria 5916
80 Ga0395899_0045789 3300037312 Bacteria 3259
81 Ga0395899_0230125 3300037312 Bacteria 1280
82 Ga0395900_0002033 3300037418 Bacteria 22731
83 Ga0395900_0038666 3300037418 Bacteria 4918
84 Ga0395898_0003533 3300037466 Bacteria 17426
85 Ga0395898_0033216 3300037466 Bacteria 5150
86 Ga0395898_0037650 3300037466 Bacteria 4797
87 Ga0395898_0046009 3300037466 Bacteria 4287
88 Ga0395898_0194882 3300037466 Bacteria 1936
89 Ga0395898_0201428 3300037466 Bacteria 1900
90 Ga0395905_0001186 3300037471 Bacteria 32597
91 Ga0395905_0051377 3300037471 Bacteria 3861
92 Ga0395905_0078474 3300037471 Bacteria 3094
93 Ga0395905_0109754 3300037471 Bacteria 2590
94 Ga0395905_0295641 3300037471 Bacteria 1506
95 Ga0395901_0001583 3300038443 Bacteria 23539
96 Ga0395901_0005175 3300038443 Bacteria 13158
97 Ga0395901_0116496 3300038443 Bacteria 2806
98 Ga0395901_0137587 3300038443 Bacteria 2567
99 Ga0395901_0230094 3300038443 Bacteria 1935
100 Ga0436361_0749269 3300039447 Bacteria 121408
101 Ga0466967_0046666 3300045976 Bacteria 3773
102 Ga0495590_0162354 3300046457 Bacteria 813
103 Ga0495629_0273501 3300046459 Bacteria 1160
104 Ga0495638_0031754 3300046460 Bacteria 3391
105 Ga0495653_0022275 3300046463 Bacteria 5128
106 Ga0495608_0095335 3300046511 Bacteria 1923
107 Ga0495652_0285979 3300046529 Unclassified 1205
108 Ga0495645_0382786 3300046543 Bacteria 900
109 Ga0495667_0060518 3300046559 Bacteria 2484
110 Ga0495634_0026416 3300046642 Bacteria 4052
111 Ga0495634_0140413 3300046642 Bacteria 1534
112 Ga0495635_0085859 3300046663 Bacteria 2153
113 Ga0495646_0287272 3300046680 Bacteria 873
114 Ga0495658_0016810 3300046683 Bacteria 3770
115 Ga0495613_0092022 3300046689 Bacteria 2196
116 Ga0495670_0247585 3300046691 Bacteria 950
117 Ga0495649_0051224 3300046694 Bacteria 2239
118 Ga0495600_0030239 3300046809 Bacteria 3508
119 Ga0495674_0074638 3300047319 Bacteria 2920
120 Ga0495680_0023486 3300047322 Bacteria 5126
121 Ga0495684_0024005 3300047471 Bacteria 4691
122 Ga0495686_0184737 3300047472 Bacteria 1206
123 Ga0496104_0184024 3300048907 Bacteria 2000
124 Ga0496108_0342707 3300048911 Bacteria 1304
125 Ga0496109_0173957 3300048912 Bacteria 2021
126 Ga0496109_0572786 3300048912 Bacteria 1064
127 Ga0496110_0617131 3300048913 Bacteria 983
128 Ga0496111_0111743 3300048914 Bacteria 2013
129 Ga0496117_0222674 3300048920 Bacteria 1049
130 Ga0501047_0019908 3300049581 Bacteria 6442
131 nmdc:mga0n895_241287_c1 3300050512 Bacteria 1834
132 Ga0500635_0035187 3300053080 Bacteria 1645
133 Ga0495655_0004543 3300053083 Bacteria 2380
134 Ga0495619_0158762 3300053085 Bacteria 1561
135 Ga0500578_0021256 3300053086 Bacteria 4171
136 Ga0500644_0017388 3300053088 Bacteria 2087
137 Ga0500646_0007366 3300053090 Bacteria 2811
138 Ga0500566_0010566 3300053094 Bacteria 5441
139 Ga0500566_0027632 3300053094 Bacteria 3321
140 Ga0500566_0056372 3300053094 Bacteria 2235
141 Ga0500566_0076054 3300053094 Bacteria 1877
142 Ga0500640_001441 3300053095 Bacteria 7213
143 Ga0500641_0002026 3300053096 Bacteria 7198
144 Ga0500554_002555 3300053102 Bacteria 3595
145 Ga0500562_018533 3300053108 Bacteria 1798
146 Ga0500594_0001775 3300053118 Bacteria 4687
147 Ga0500595_001472 3300053119 Bacteria 12521
148 Ga0500597_060434 3300053120 Bacteria 1628
149 Ga0500614_000477 3300053123 Bacteria 10413
150 Ga0500614_009780 3300053123 Bacteria 2048
151 Ga0500642_0030290 3300053130 Bacteria 2250
152 Ga0500652_006128 3300053131 Bacteria 3848
153 Ga0500559_0004591 3300053136 Bacteria 6527
154 Ga0500564_076825 3300053138 Bacteria 1501
155 Ga0500603_000381 3300053150 Bacteria 11591
156 Ga0500616_0188289 3300053153 Bacteria 923
157 Ga0500619_006595 3300053154 Bacteria 2685
158 Ga0500622_0039184 3300053156 Bacteria 2471
159 Ga0500630_034263 3300053159 Bacteria 2490
160 Ga0500636_0052743 3300053177 Bacteria 2388
161 Ga0500611_003403 3300053727 Bacteria 2034
162 Ga0500601_003376 3300053737 Bacteria 1731
163 2729907734 2728369276 Bacteria 5610032
164 8047713149 8047710418 Bacteria 11023148
165 8056040296 8056037122 Bacteria 3854319
166 Ga0395898_0005503
167 Ga0070683_100400338
168 Ga0068869_100085561
169 Ga0070689_100224581
170 Ga0070687_100171255
171 Ga0070674_100197237
172 Ga0070713_100207410
173 Ga0070694_100203782
174 Ga0070708_100184001
175 Ga0070706_100015551
176 Ga0070707_100046199
177 Ga0070698_100095312
178 Ga0070679_100256715
179 Ga0068853_100006996
180 Ga0070696_100161279
181 Ga0068856_100018226
182 Ga0068864_100222717
183 Ga0070717_10004048
184 Ga0070717_10189297
185 Ga0070712_100033038
186 Ga0075434_100061625
187 Ga0075435_100362910
188 Ga0105243_10455456
189 Ga0157375_10193126
190 Ga0163163_10297997
191 Ga0157380_10189166
192 Ga0213872_10000055
193 Ga0207684_10056721
194 Ga0207693_10124734
195 Ga0207652_10212566
196 Ga0207646_10017223
197 Ga0207706_10759711
198 Ga0207670_10116837
199 Ga0207639_10002114
200 Ga0207708_10141455
201 Ga0207702_10035775
202 Ga0207676_10149841
203 Ga0207675_100555545
204 Ga0268264_10302411
205 Ga0265336_10023258
206 Ga0307517_10062745
207 Ga0307517_10099905
208 Ga0307515_10012587
209 Ga0307515_10276089
210 Ga0265338_10000705
211 Ga0265338_10003496
212 Ga0265338_10042926
213 Ga0307512_10006805
214 Ga0265330_10032182
215 Ga0265330_10081213
216 Ga0265332_10014252
217 Ga0265332_10033116
218 Ga0265325_10002950
219 Ga0265340_10019850
220 Ga0265339_10005383
221 Ga0265339_10009500
222 Ga0265327_10008065
223 Ga0265316_10007733
224 Ga0265316_10107154
225 Ga0307513_10006742
226 Ga0307513_10009547
227 Ga0307509_10038283
228 Ga0265313_10010708
229 Ga0265313_10013553
230 Ga0265313_10019987
231 Ga0307508_10005139
232 Ga0307508_10023213
233 Ga0265314_10008844
234 Ga0265314_10026496
235 Ga0265314_10101987
236 Ga0265342_10070140
237 Ga0265342_10083149
238 Ga0265342_10136720
239 Ga0307516_10015073
240 Ga0373949_0000018
241 Ga0373941_0000853
242 Ga0373937_0062912
243 Ga0373925_0002693
244 Ga0395899_0014971
245 Ga0395899_0045789
246 Ga0395899_0230125
247 Ga0395900_0002033
248 Ga0395900_0038666
249 Ga0395898_0003533
250 Ga0395898_0033216
251 Ga0395898_0037650
252 Ga0395898_0046009
253 Ga0395898_0194882
254 Ga0395898_0201428
255 Ga0395905_0001186
256 Ga0395905_0051377
257 Ga0395905_0078474
258 Ga0395905_0109754
259 Ga0395905_0295641
260 Ga0395901_0001583
261 Ga0395901_0005175
262 Ga0395901_0116496
263 Ga0395901_0137587
264 Ga0395901_0230094
265 Ga0436361_0749269
266 Ga0466967_0046666
267 Ga0495590_0162354
268 Ga0495629_0273501
269 Ga0495638_0031754
270 Ga0495653_0022275
271 Ga0495608_0095335
272 Ga0495652_0285979
273 Ga0495645_0382786
274 Ga0495667_0060518
275 Ga0495634_0026416
276 Ga0495634_0140413
277 Ga0495635_0085859
278 Ga0495646_0287272
279 Ga0495658_0016810
280 Ga0495613_0092022
281 Ga0495670_0247585
282 Ga0495649_0051224
283 Ga0495600_0030239
284 Ga0495674_0074638
285 Ga0495680_0023486
286 Ga0495684_0024005
287 Ga0495686_0184737
288 Ga0496104_0184024
289 Ga0496108_0342707
290 Ga0496109_0173957
291 Ga0496109_0572786
292 Ga0496110_0617131
293 Ga0496111_0111743
294 Ga0496117_0222674
295 Ga0501047_0019908
296 nmdc:mga0n895_241287_c1
297 Ga0500635_0035187
298 Ga0495655_0004543
299 Ga0495619_0158762
300 Ga0500578_0021256
301 Ga0500644_0017388
302 Ga0500646_0007366
303 Ga0500566_0010566
304 Ga0500566_0027632
305 Ga0500566_0056372
306 Ga0500566_0076054
307 Ga0500640_001441
308 Ga0500641_0002026
309 Ga0500554_002555
310 Ga0500562_018533
311 Ga0500594_0001775
312 Ga0500595_001472
313 Ga0500597_060434
314 Ga0500614_000477
315 Ga0500614_009780
316 Ga0500642_0030290
317 Ga0500652_006128
318 Ga0500559_0004591
319 Ga0500564_076825
320 Ga0500603_000381
321 Ga0500616_0188289
322 Ga0500619_006595
323 Ga0500622_0039184
324 Ga0500630_034263
325 Ga0500636_0052743
326 Ga0500611_003403
327 Ga0500601_003376
328 2729907734
329 8047713149
330 8056040296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

63

219

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.9018 20 244
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.9007 20 244
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.8951 20 254
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8949 17 241
2r6g-assembly1.cif.gz_A the crystal structure of the e. coli maltose transporter 0.8947 20 244
ID Description Score Start End Superfamily
af_P04983_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9686 17 256 3.40.50.300
af_P0AAF3_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9593 14 254 3.40.50.300
af_P32721_2_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9484 16 256 3.40.50.300
af_P0AAF3_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9477 14 254 3.40.50.300
af_P04983_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9453 17 256 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3A9F3A8-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9474 15 256 GO:0005524
GO:0016887
AF-A0A4Q9VWW9-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9446 15 256 GO:0005524
GO:0016887
AF-A0A2T0UCU5-F1-model_v4 Monosaccharide ABC transporter ATP-binding protein (CUT2 family) 0.9437 20 257 GO:0005524
GO:0016887
AF-A0A7C6ZYA4-F1-model_v4 ATP-binding cassette domain-containing protein 0.94 15 256 GO:0005524
GO:0016887
AF-A0A2N3FF34-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9389 11 256 GO:0005524
GO:0016887

Map