F245367

General Info

Members Datasets Scaffolds Average Seq Length
165 136 164 99

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_101567572|Ga0070690_1015675721
Length 113
Sequence LARATRTRQEDTASQAGATVVYGAKALSDLERLFRFLLQHDQASAVASSAAIRGAIEMLSEHPLIGRRIAGDVRELVLSFGRTGYIALYRFVPAVEEVRILSIRHQREIGYPG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
73 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 1.21
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 1.82
Rhizosphere 91.52
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_850602 2162886007 Bacteria 3511
2 rootL2_10094738 3300003322 Bacteria 2829
3 Ga0065704_10013803 3300005289 Bacteria 2507
4 Ga0070676_10115176 3300005328 Bacteria 1679
5 Ga0070690_100135225 3300005330 Bacteria 1669
6 Ga0070690_101567572 3300005330 Unclassified 533
7 Ga0070670_100383438 3300005331 Bacteria 1238
8 Ga0070670_101973642 3300005331 Bacteria 537
9 Ga0068869_100492312 3300005334 Unclassified 1022
10 Ga0068869_100631347 3300005334 Plasmid 908
11 Ga0070689_100233164 3300005340 Bacteria 1514
12 Ga0070689_100878321 3300005340 Bacteria 792
13 Ga0070687_100234593 3300005343 Plasmid 1131
14 Ga0070661_101056244 3300005344 Plasmid 675
15 Ga0070669_100315815 3300005353 Bacteria 1260
16 Ga0070669_100583242 3300005353 Plasmid 935
17 Ga0070663_101443635 3300005455 Unclassified 610
18 Ga0070678_100705829 3300005456 Bacteria 909
19 Ga0070678_101060144 3300005456 Bacteria 747
20 Ga0070681_11564844 3300005458 Unclassified 584
21 Ga0070698_100972338 3300005471 Bacteria 796
22 Ga0070697_101311576 3300005536 Unclassified 646
23 Ga0070696_100789126 3300005546 Plasmid 781
24 Ga0070665_102034035 3300005548 Plasmid 579
25 Ga0070704_101261422 3300005549 Unclassified 675
26 Ga0070664_102252792 3300005564 Plasmid 517
27 Ga0068854_100950507 3300005578 Plasmid 758
28 Ga0068856_100432797 3300005614 Plasmid 1336
29 Ga0068859_100036890 3300005617 Bacteria 4907
30 Ga0068859_100686802 3300005617 Bacteria 1115
31 Ga0068864_100759949 3300005618 Unclassified 950
32 Ga0068866_11222459 3300005718 Unclassified 543
33 Ga0068861_100784285 3300005719 Bacteria 893
34 Ga0068870_10340199 3300005840 Unclassified 959
35 Ga0068863_102419533 3300005841 Unclassified 535
36 Ga0068858_101280180 3300005842 Unclassified 721
37 Ga0068860_100023399 3300005843 Bacteria 5970
38 Ga0068860_100830316 3300005843 Bacteria 938
39 Ga0068862_100133958 3300005844 Bacteria 2194
40 Ga0068862_101352035 3300005844 Unclassified 715
41 Ga0081540_1061233 3300005983 Plasmid 1795
42 Ga0097621_101177847 3300006237 Unclassified 721
43 Ga0075430_100469911 3300006846 Bacteria 1038
44 Ga0075431_100648251 3300006847 Bacteria 1037
45 Ga0075433_10128033 3300006852 Bacteria 2255
46 Ga0075433_10339736 3300006852 Unclassified 1327
47 Ga0075434_101081994 3300006871 Bacteria 815
48 Ga0097620_100036891 3300006931 Bacteria 4907
49 Ga0097620_100686822 3300006931 Bacteria 1115
50 Ga0099794_10037012 3300007265 Bacteria 2309
51 Ga0099794_10199074 3300007265 Bacteria 1025
52 Ga0111539_10974563 3300009094 Bacteria 986
53 Ga0105245_10627102 3300009098 Bacteria 1104
54 Ga0105242_11138037 3300009176 Plasmid 796
55 Ga0105237_10764885 3300009545 Bacteria 973
56 Ga0105249_10633568 3300009553 Bacteria 1126
57 Ga0105239_10883042 3300010375 Unclassified 1026
58 Ga0105246_11218684 3300011119 Unclassified 693
59 Ga0157373_11277167 3300013100 Plasmid 555
60 Ga0157374_10467390 3300013296 Plasmid 1264
61 Ga0157378_11574089 3300013297 Bacteria 703
62 Ga0157378_12019811 3300013297 Unclassified 627
63 Ga0163162_10468545 3300013306 Bacteria 1391
64 Ga0157375_10133362 3300013308 Bacteria 2605
65 Ga0157375_11308945 3300013308 Plasmid 852
66 Ga0163163_12426195 3300014325 Bacteria 583
67 Ga0157380_10084231 3300014326 Bacteria 2606
68 Ga0157380_10638484 3300014326 Bacteria 1060
69 Ga0157380_11148445 3300014326 Plasmid 818
70 Ga0157380_11338259 3300014326 Bacteria 765
71 Ga0157379_11178883 3300014968 Unclassified 736
72 Ga0163161_11869004 3300017792 Bacteria 534
73 Ga0213872_10082366 3300021361 Plasmid 1444
74 Ga0207646_11622703 3300025922 Unclassified 557
75 Ga0207681_10431027 3300025923 Bacteria 1070
76 Ga0207681_10561515 3300025923 Plasmid 940
77 Ga0207659_10450078 3300025926 Bacteria 1084
78 Ga0207659_10831866 3300025926 Unclassified 793
79 Ga0207669_10900895 3300025937 Bacteria 739
80 Ga0207691_10246957 3300025940 Unclassified 1541
81 Ga0207691_11211755 3300025940 Bacteria 626
82 Ga0207689_10678405 3300025942 Plasmid 869
83 Ga0207679_10196176 3300025945 Unclassified 1683
84 Ga0207651_10867124 3300025960 Bacteria 803
85 Ga0207668_10767768 3300025972 Unclassified 851
86 Ga0207658_10254815 3300025986 Bacteria 1493
87 Ga0207702_10271119 3300026078 Plasmid 1601
88 Ga0207648_10517263 3300026089 Bacteria 1093
89 Ga0207676_12499211 3300026095 Unclassified 513
90 Ga0207683_11364869 3300026121 Bacteria 656
91 Ga0265354_1001635 3300028016 Unclassified 3119
92 Ga0265355_1026916 3300028036 Unclassified 508
93 Ga0265336_10033414 3300028666 Bacteria 1593
94 Ga0307515_10422481 3300028794 Plasmid 953
95 Ga0307511_10000065 3300030521 Bacteria 88859
96 Ga0265765_1001253 3300030879 Unclassified 2308
97 Ga0265760_10000437 3300031090 Bacteria 11683
98 Ga0265328_10081056 3300031239 Unclassified 1196
99 Ga0265325_10429479 3300031241 Unclassified 577
100 Ga0265327_10002234 3300031251 Bacteria 21022
101 Ga0265316_10096101 3300031344 Plasmid 2256
102 Ga0307513_10035597 3300031456 Bacteria 5567
103 Ga0307514_10001002 3300031649 Bacteria 41404
104 Ga0265314_10133946 3300031711 Plasmid 1542
105 Ga0307516_10000124 3300031730 Bacteria 90831
106 Ga0307516_10748175 3300031730 Bacteria 637
107 Ga0307406_10047235 3300031901 Bacteria 2712
108 Ga0307416_103596297 3300032002 Unclassified 519
109 Ga0307414_10318219 3300032004 Bacteria 1323
110 Ga0307415_100148208 3300032126 Bacteria 1802
111 Ga0373926_0002891 3300035083 Bacteria 5504
112 Ga0373939_0416537 3300035114 Bacteria 559
113 Ga0373946_0022365 3300035171 Bacteria 2460
114 Ga0373935_0110579 3300035692 Bacteria 1823
115 Ga0373927_0025495 3300035695 Bacteria 3866
116 Ga0373947_0035366 3300035725 Bacteria 2957
117 Ga0373937_0981114 3300036401 Bacteria 794
118 Ga0373925_0193266 3300037068 Bacteria 1615
119 Ga0436360_1338750 3300039438 Bacteria 2066
120 Ga0436361_0576909 3300039447 Bacteria 1206
121 Ga0451791_1799091 3300041451 Bacteria 1193
122 Ga0439434_0111996 3300042435 Bacteria 885
123 Ga0451577_1102170 3300042876 Bacteria 710
124 Ga0451577_1313573 3300042876 Unclassified 643
125 Ga0453683_0369732 3300044673 Bacteria 922
126 Ga0451576_1503856 3300045051 Bacteria 699
127 Ga0451576_1971337 3300045051 Archaea 602
128 Ga0495638_0244508 3300046460 Unclassified 992
129 Ga0495639_0743589 3300046475 Bacteria 507
130 Ga0495632_0115106 3300046519 Unclassified 1260
131 Ga0495622_0052568 3300046557 Bacteria 1890
132 Ga0495625_0005970 3300046660 Bacteria 10946
133 Ga0495624_0756460 3300046690 Bacteria 575
134 Ga0495589_0557135 3300046794 Unclassified 522
135 Ga0495676_0315746 3300047321 Bacteria 1051
136 Ga0495676_0898133 3300047321 Bacteria 568
137 Ga0496102_0607610 3300048905 Plasmid 1017
138 Ga0496108_1213084 3300048911 Plasmid 637
139 Ga0496118_0089900 3300048921 Bacteria 2118
140 Ga0501034_0096622 3300049571 Bacteria 2950
141 Ga0501034_1630267 3300049571 Unclassified 518
142 Ga0501040_0026225 3300049576 Bacteria 3920
143 Ga0501041_0018611 3300049577 Bacteria 4137
144 Ga0501041_0309013 3300049577 Bacteria 997
145 Ga0501042_0075628 3300049578 Bacteria 2410
146 Ga0501047_0935897 3300049581 Plasmid 680
147 Ga0501067_0224710 3300049583 Bacteria 1045
148 Ga0501069_0002047 3300049585 Bacteria 10119
149 Ga0501070_0009023 3300049586 Bacteria 8437
150 Ga0501072_0345085 3300049588 Bacteria 1182
151 Ga0501072_0755518 3300049588 Bacteria 763
152 Ga0501074_0253628 3300049590 Bacteria 1251
153 Ga0501074_0718610 3300049590 Bacteria 705
154 Ga0501075_0177975 3300049591 Bacteria 1623
155 Ga0501076_1547664 3300049592 Unclassified 544
156 Ga0501080_0688488 3300049742 Bacteria 902
157 Ga0501035_0792791 3300049822 Unclassified 757
158 nmdc:mga08y16_683090_c1 3300050511 Bacteria 1028
159 nmdc:mga0n895_243958_c1 3300050512 Bacteria 1823
160 nmdc:mga0rr50_765508_c1 3300050513 Bacteria 824
161 nmdc:mga0a205_115071_c1 3300050515 Bacteria 2298
162 nmdc:mga0a205_409810_c1 3300050515 Plasmid 1218
163 Ga0500583_0000897 3300053092 Bacteria 8557
164 Ga0500568_0226519 3300053139 Bacteria 682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10094738 rootL2_100947384 80
2 iso_pu_bacteria 2751185897 2753764750 90
3 3300013297 Ga0157378_11574089 Ga0157378_115740891 91
4 3300021361 Ga0213872_10082366 Ga0213872_100823663 93
5 3300031241 Ga0265325_10429479 Ga0265325_104294791 93
6 3300031649 Ga0307514_10001002 Ga0307514_1000100213 93
7 3300031730 Ga0307516_10748175 Ga0307516_107481752 93
8 3300039438 Ga0436360_1338750 Ga0436360_1338750_149_439 93
9 3300039447 Ga0436361_0576909 Ga0436361_0576909_633_923 93
10 3300049581 Ga0501047_0935897 Ga0501047_0935897_111_401 93
11 3300049585 Ga0501069_0002047 Ga0501069_0002047_9219_9509 93
12 3300049586 Ga0501070_0009023 Ga0501070_0009023_664_954 93
13 3300049590 Ga0501074_0253628 Ga0501074_0253628_610_900 93
14 3300009176 Ga0105242_11138037 Ga0105242_111380372 94
15 3300013297 Ga0157378_12019811 Ga0157378_120198112 94
16 3300014325 Ga0163163_12426195 Ga0163163_124261952 94
17 3300014326 Ga0157380_10638484 Ga0157380_106384842 94
18 3300046660 Ga0495625_0005970 Ga0495625_0005970_9121_9414 94
19 3300005456 Ga0070678_101060144 Ga0070678_1010601441 95
20 3300014326 Ga0157380_11338259 Ga0157380_113382591 95
21 3300017792 Ga0163161_11869004 Ga0163161_118690042 95
22 3300047321 Ga0495676_0315746 Ga0495676_0315746_178_465 95
23 3300049571 Ga0501034_1630267 Ga0501034_1630267_101_388 95
24 3300049576 Ga0501040_0026225 Ga0501040_0026225_262_549 95
25 3300049577 Ga0501041_0018611 Ga0501041_0018611_3213_3500 95
26 3300049578 Ga0501042_0075628 Ga0501042_0075628_1124_1411 95
27 3300049588 Ga0501072_0345085 Ga0501072_0345085_410_697 95
28 3300049822 Ga0501035_0792791 Ga0501035_0792791_12_299 95
29 3300005617 Ga0068859_100686802 Ga0068859_1006868022 96
30 3300006846 Ga0075430_100469911 Ga0075430_1004699113 96
31 3300006847 Ga0075431_100648251 Ga0075431_1006482512 96
32 3300006931 Ga0097620_100686822 Ga0097620_1006868222 96
33 3300007265 Ga0099794_10199074 Ga0099794_101990742 96
34 3300030521 Ga0307511_10000065 Ga0307511_1000006526 96
35 3300031251 Ga0265327_10002234 Ga0265327_100022343 96
36 3300031901 Ga0307406_10047235 Ga0307406_100472353 96
37 3300032004 Ga0307414_10318219 Ga0307414_103182191 96
38 3300032126 Ga0307415_100148208 Ga0307415_1001482083 96
39 3300049577 Ga0501041_0309013 Ga0501041_0309013_654_944 96
40 3300049588 Ga0501072_0755518 Ga0501072_0755518_433_723 96
41 3300049590 Ga0501074_0718610 Ga0501074_0718610_30_320 96
42 3300049591 Ga0501075_0177975 Ga0501075_0177975_1219_1509 96
43 3300049592 Ga0501076_1547664 Ga0501076_1547664_76_366 96
44 3300049742 Ga0501080_0688488 Ga0501080_0688488_476_766 96
45 3300053092 Ga0500583_0000897 Ga0500583_0000897_882_1172 96
46 3300053139 Ga0500568_0226519 Ga0500568_0226519_254_544 96
47 3300005328 Ga0070676_10115176 Ga0070676_101151763 97
48 3300005330 Ga0070690_100135225 Ga0070690_1001352252 97
49 3300005330 Ga0070690_101567572 Ga0070690_1015675721 97
50 3300005331 Ga0070670_100383438 Ga0070670_1003834384 97
51 3300005331 Ga0070670_101973642 Ga0070670_1019736421 97
52 3300005334 Ga0068869_100492312 Ga0068869_1004923122 97
53 3300005334 Ga0068869_100631347 Ga0068869_1006313472 97
54 3300005340 Ga0070689_100233164 Ga0070689_1002331642 97
55 3300005340 Ga0070689_100878321 Ga0070689_1008783212 97
56 3300005343 Ga0070687_100234593 Ga0070687_1002345933 97
57 3300005344 Ga0070661_101056244 Ga0070661_1010562442 97
58 3300005353 Ga0070669_100315815 Ga0070669_1003158154 97
59 3300005353 Ga0070669_100583242 Ga0070669_1005832422 97
60 3300005455 Ga0070663_101443635 Ga0070663_1014436351 97
61 3300005456 Ga0070678_100705829 Ga0070678_1007058292 97
62 3300005458 Ga0070681_11564844 Ga0070681_115648441 97
63 3300005471 Ga0070698_100972338 Ga0070698_1009723382 97
64 3300005536 Ga0070697_101311576 Ga0070697_1013115762 97
65 3300005546 Ga0070696_100789126 Ga0070696_1007891262 97
66 3300005548 Ga0070665_102034035 Ga0070665_1020340351 97
67 3300005549 Ga0070704_101261422 Ga0070704_1012614222 97
68 3300005564 Ga0070664_102252792 Ga0070664_1022527921 97
69 3300005578 Ga0068854_100950507 Ga0068854_1009505072 97
70 3300005614 Ga0068856_100432797 Ga0068856_1004327973 97
71 3300005617 Ga0068859_100036890 Ga0068859_1000368904 97
72 3300005618 Ga0068864_100759949 Ga0068864_1007599492 97
73 3300005718 Ga0068866_11222459 Ga0068866_112224591 97
74 3300005719 Ga0068861_100784285 Ga0068861_1007842852 97
75 3300005840 Ga0068870_10340199 Ga0068870_103401993 97
76 3300005841 Ga0068863_102419533 Ga0068863_1024195332 97
77 3300005842 Ga0068858_101280180 Ga0068858_1012801802 97
78 3300005843 Ga0068860_100023399 Ga0068860_1000233995 97
79 3300005843 Ga0068860_100830316 Ga0068860_1008303162 97
80 3300005844 Ga0068862_100133958 Ga0068862_1001339582 97
81 3300005844 Ga0068862_101352035 Ga0068862_1013520352 97
82 3300005983 Ga0081540_1061233 Ga0081540_10612332 97
83 3300006237 Ga0097621_101177847 Ga0097621_1011778472 97
84 3300006852 Ga0075433_10128033 Ga0075433_101280332 97
85 3300006852 Ga0075433_10339736 Ga0075433_103397362 97
86 3300006871 Ga0075434_101081994 Ga0075434_1010819942 97
87 3300006931 Ga0097620_100036891 Ga0097620_1000368913 97
88 3300007265 Ga0099794_10037012 Ga0099794_100370122 97
89 3300009094 Ga0111539_10974563 Ga0111539_109745632 97
90 3300009098 Ga0105245_10627102 Ga0105245_106271021 97
91 3300009545 Ga0105237_10764885 Ga0105237_107648853 97
92 3300009553 Ga0105249_10633568 Ga0105249_106335681 97
93 3300010375 Ga0105239_10883042 Ga0105239_108830422 97
94 3300011119 Ga0105246_11218684 Ga0105246_112186842 97
95 3300013100 Ga0157373_11277167 Ga0157373_112771671 97
96 3300013296 Ga0157374_10467390 Ga0157374_104673902 97
97 3300013306 Ga0163162_10468545 Ga0163162_104685453 97
98 3300013308 Ga0157375_10133362 Ga0157375_101333624 97
99 3300013308 Ga0157375_11308945 Ga0157375_113089452 97
100 3300014326 Ga0157380_10084231 Ga0157380_100842313 97
101 3300014326 Ga0157380_11148445 Ga0157380_111484452 97
102 3300014968 Ga0157379_11178883 Ga0157379_111788832 97
103 3300025922 Ga0207646_11622703 Ga0207646_116227032 97
104 3300025923 Ga0207681_10431027 Ga0207681_104310272 97
105 3300025923 Ga0207681_10561515 Ga0207681_105615152 97
106 3300025926 Ga0207659_10450078 Ga0207659_104500782 97
107 3300025926 Ga0207659_10831866 Ga0207659_108318662 97
108 3300025937 Ga0207669_10900895 Ga0207669_109008951 97
109 3300025940 Ga0207691_10246957 Ga0207691_102469572 97
110 3300025940 Ga0207691_11211755 Ga0207691_112117552 97
111 3300025942 Ga0207689_10678405 Ga0207689_106784052 97
112 3300025945 Ga0207679_10196176 Ga0207679_101961763 97
113 3300025960 Ga0207651_10867124 Ga0207651_108671242 97
114 3300025972 Ga0207668_10767768 Ga0207668_107677681 97
115 3300025986 Ga0207658_10254815 Ga0207658_102548152 97
116 3300026078 Ga0207702_10271119 Ga0207702_102711191 97
117 3300026089 Ga0207648_10517263 Ga0207648_105172632 97
118 3300026095 Ga0207676_12499211 Ga0207676_124992111 97
119 3300026121 Ga0207683_11364869 Ga0207683_113648692 97
120 3300028016 Ga0265354_1001635 Ga0265354_10016353 97
121 3300028036 Ga0265355_1026916 Ga0265355_10269162 97
122 3300028666 Ga0265336_10033414 Ga0265336_100334141 97
123 3300030879 Ga0265765_1001253 Ga0265765_10012534 97
124 3300031090 Ga0265760_10000437 Ga0265760_100004376 97
125 3300031239 Ga0265328_10081056 Ga0265328_100810561 97
126 3300031344 Ga0265316_10096101 Ga0265316_100961013 97
127 3300031711 Ga0265314_10133946 Ga0265314_101339461 97
128 3300031730 Ga0307516_10000124 Ga0307516_1000012425 97
129 3300032002 Ga0307416_103596297 Ga0307416_1035962972 97
130 3300035083 Ga0373926_0002891 Ga0373926_0002891_3676_3969 97
131 3300035114 Ga0373939_0416537 Ga0373939_0416537_166_459 97
132 3300035171 Ga0373946_0022365 Ga0373946_0022365_1829_2122 97
133 3300035692 Ga0373935_0110579 Ga0373935_0110579_326_619 97
134 3300035695 Ga0373927_0025495 Ga0373927_0025495_813_1106 97
135 3300035725 Ga0373947_0035366 Ga0373947_0035366_2284_2577 97
136 3300036401 Ga0373937_0981114 Ga0373937_0981114_16_309 97
137 3300037068 Ga0373925_0193266 Ga0373925_0193266_276_569 97
138 3300041451 Ga0451791_1799091 Ga0451791_1799091_772_1071 97
139 3300042435 Ga0439434_0111996 Ga0439434_0111996_17_316 97
140 3300042876 Ga0451577_1102170 Ga0451577_1102170_204_500 97
141 3300042876 Ga0451577_1313573 Ga0451577_1313573_19_312 97
142 3300044673 Ga0453683_0369732 Ga0453683_0369732_303_596 97
143 3300045051 Ga0451576_1503856 Ga0451576_1503856_60_356 97
144 3300045051 Ga0451576_1971337 Ga0451576_1971337_138_431 97
145 3300046460 Ga0495638_0244508 Ga0495638_0244508_418_711 97
146 3300046475 Ga0495639_0743589 Ga0495639_0743589_127_420 97
147 3300046519 Ga0495632_0115106 Ga0495632_0115106_97_390 97
148 3300046557 Ga0495622_0052568 Ga0495622_0052568_995_1288 97
149 3300046690 Ga0495624_0756460 Ga0495624_0756460_98_391 97
150 3300046794 Ga0495589_0557135 Ga0495589_0557135_205_498 97
151 3300047321 Ga0495676_0898133 Ga0495676_0898133_135_428 97
152 3300048905 Ga0496102_0607610 Ga0496102_0607610_422_715 97
153 3300048911 Ga0496108_1213084 Ga0496108_1213084_12_305 97
154 3300048921 Ga0496118_0089900 Ga0496118_0089900_62_355 97
155 3300049571 Ga0501034_0096622 Ga0501034_0096622_2641_2940 97
156 3300050511 nmdc:mga08y16_683090_c1 nmdc:mga08y16_683090_c1_245_538 97
157 3300050512 nmdc:mga0n895_243958_c1 nmdc:mga0n895_243958_c1_1477_1770 97
158 3300050513 nmdc:mga0rr50_765508_c1 nmdc:mga0rr50_765508_c1_479_772 97
159 3300050515 nmdc:mga0a205_115071_c1 nmdc:mga0a205_115071_c1_1688_1981 97
160 3300050515 nmdc:mga0a205_409810_c1 nmdc:mga0a205_409810_c1_279_572 97
161 3300028794 Ga0307515_10422481 Ga0307515_104224811 98
162 3300031456 Ga0307513_10035597 Ga0307513_100355973 98
163 3300049583 Ga0501067_0224710 Ga0501067_0224710_643_939 98
164 2162886007 SwRhRL2b_contig_850602 SwRhRL2b_0349.00000590 99
165 3300005289 Ga0065704_10013803 Ga0065704_100138033 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

20

110

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7etr-assembly1.cif.gz_C crystal structure of so_1444-so_1445 complex from shewanella oneidensis 0.9019 3 88
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.8875 2 91
6x0a-assembly17.cif.gz_Q x-ray structure of a chimeric parde toxin-antitoxin complex from mesorhizobium opportunistum 0.8792 4 89
7etr-assembly1.cif.gz_C crystal structure of so_1444-so_1445 complex from shewanella oneidensis 0.8616 3 88
3kxe-assembly1.cif.gz_B a conserved mode of protein recognition and binding in a pard-pare toxin-antitoxin complex 0.8603 4 91
ID Description Score Start End Superfamily
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8894 3 91 3.30.2310.20
5cegD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8802 3 92 3.30.2310.20
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8639 2 91 3.30.2310.20
af_A4IBB8_108_394_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8615 67 88 3.30.470.20
3kxeB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8521 4 91 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A534CU95-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9858 1 98
AF-A0A534CU95-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.976 1 98
AF-A0A1I6STS1-F1-model_v4 Plasmid stabilization system protein ParE 0.9608 2 91
AF-A0A514C298-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9593 2 92
AF-A0A1I6PY46-F1-model_v4 Plasmid stabilization system protein ParE 0.9586 1 91

Feature Viewer

pLDDT pTM Quality
87.49 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map