F244050

General Info

Members Datasets Scaffolds Average Seq Length
164 122 158 86

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10336620|Ga0207652_103366204
Length 83
Sequence MHIWPVQAKARFSELLDTCLEKGPQTVSRRGQEAAVLVPIDQWRRLTAGKPTLKELLLADEPRADIPVPPRGRRRHRTPPSFR

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
3 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
4 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
5 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
34 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
47 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
48 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
55 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
56 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
57 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
64 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
65 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
73 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
74 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
75 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
78 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
79 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
80 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
81 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
84 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
114 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
115 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
116 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
117 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
118 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
122 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 1.22
Rhizosphere 85.98
Stem 0
Stem Tuber 0
Unclassified 7.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100098720 3300005340 Bacteria 2310
2 Ga0070689_100411743 3300005340 Bacteria 1144
3 Ga0070675_101671556 3300005354 Bacteria 587
4 Ga0070708_100232538 3300005445 Bacteria 1730
5 Ga0070681_10515504 3300005458 Bacteria 1109
6 Ga0070685_10550776 3300005466 Unclassified 823
7 Ga0070679_100308964 3300005530 Bacteria 1531
8 Ga0070679_101067935 3300005530 Bacteria 752
9 Ga0070672_100428258 3300005543 Bacteria 1137
10 Ga0070702_101824217 3300005615 Unclassified 508
11 Ga0068859_102152323 3300005617 Unclassified 616
12 Ga0081455_10072039 3300005937 Bacteria 2863
13 Ga0081539_10019178 3300005985 Bacteria 4693
14 Ga0075366_10050746 3300006195 Bacteria 2464
15 Ga0075428_100526735 3300006844 Unclassified 1264
16 Ga0075430_100398588 3300006846 Bacteria 1136
17 Ga0075430_100449385 3300006846 Unclassified 1064
18 Ga0075429_100651475 3300006880 Unclassified 923
19 Ga0075436_101510642 3300006914 Bacteria 510
20 Ga0097620_102152447 3300006931 Unclassified 616
21 Ga0099795_10024663 3300007788 Bacteria 2009
22 Ga0114129_10062056 3300009147 Bacteria 5222
23 Ga0114129_10740139 3300009147 Unclassified 1260
24 Ga0105243_11163550 3300009148 Bacteria 783
25 Ga0105243_11682263 3300009148 Unclassified 663
26 Ga0105242_11257625 3300009176 Bacteria 762
27 Ga0105248_10450106 3300009177 Bacteria 1451
28 Ga0105248_11821912 3300009177 Unclassified 690
29 Ga0099796_10006788 3300010159 Bacteria 2953
30 Ga0157370_11179341 3300013104 Bacteria 691
31 Ga0157375_11254310 3300013308 Bacteria 870
32 Ga0163163_11382939 3300014325 Bacteria 766
33 Ga0157380_10742823 3300014326 Bacteria 992
34 Ga0157380_11711403 3300014326 Bacteria 687
35 Ga0213872_10001675 3300021361 Bacteria 13952
36 Ga0213872_10313897 3300021361 Unclassified 648
37 Ga0213871_10064193 3300021441 Bacteria 1027
38 Ga0209050_1008126 3300025298 Bacteria 5688
39 Ga0209257_1003311 3300025304 Bacteria 13996
40 Ga0207697_10116149 3300025315 Bacteria 1149
41 Ga0207652_10336620 3300025921 Bacteria 1362
42 Ga0207686_11165342 3300025934 Bacteria 630
43 Ga0207670_10187057 3300025936 Bacteria 1564
44 Ga0207670_10267753 3300025936 Bacteria 1327
45 Ga0207669_10912985 3300025937 Unclassified 734
46 Ga0207691_10721996 3300025940 Unclassified 840
47 Ga0207711_10571274 3300025941 Bacteria 1055
48 Ga0207711_11915176 3300025941 Unclassified 536
49 Ga0268264_11485293 3300028381 Unclassified 688
50 Ga0268264_12275894 3300028381 Unclassified 549
51 Ga0265318_10156368 3300028577 Unclassified 836
52 Ga0307512_10072194 3300030522 Bacteria 2555
53 Ga0265328_10086717 3300031239 Bacteria 1155
54 Ga0265340_10013354 3300031247 Bacteria 4315
55 Ga0265327_10111603 3300031251 Unclassified 1306
56 Ga0307509_10834684 3300031507 Bacteria 586
57 Ga0265314_10308815 3300031711 Unclassified 884
58 Ga0265342_10146373 3300031712 Bacteria 1315
59 Ga0307516_10713843 3300031730 Bacteria 660
60 Ga0307507_10036865 3300033179 Bacteria 4989
61 Ga0373932_0098145 3300035112 Bacteria 949
62 Ga0373941_0122870 3300035115 Bacteria 927
63 Ga0373927_0240226 3300035695 Bacteria 1190
64 Ga0373927_0308974 3300035695 Bacteria 1041
65 Ga0373927_0373487 3300035695 Bacteria 940
66 Ga0373927_0481332 3300035695 Bacteria 820
67 Ga0373927_0940951 3300035695 Unclassified 570
68 Ga0373937_0200034 3300036401 Bacteria 1878
69 Ga0436364_1215350 3300037853 Bacteria 6433
70 Ga0436365_0431361 3300039437 Bacteria 4618
71 Ga0436360_0290779 3300039438 Unclassified 1110
72 Ga0436360_0600891 3300039438 Bacteria 2223
73 Ga0436361_0094673 3300039447 Bacteria 2810
74 Ga0436361_0379549 3300039447 Unclassified 946
75 Ga0436363_0009625 3300039450 Bacteria 1778
76 Ga0436362_1048807 3300039453 Unclassified 754
77 Ga0436362_1053170 3300039453 Bacteria 1001
78 Ga0439454_096855 3300042011 Bacteria 551
79 Ga0466966_0291448 3300044684 Bacteria 981
80 Ga0453684_0000102 3300044712 Bacteria 366870
81 Ga0466971_0093512 3300044719 Bacteria 1378
82 Ga0466959_0916139 3300045049 Bacteria 585
83 Ga0466958_0601357 3300045836 Bacteria 715
84 Ga0495592_0538146 3300046454 Unclassified 720
85 Ga0495664_0644488 3300046477 Unclassified 628
86 Ga0495652_0270198 3300046529 Unclassified 1250
87 Ga0495586_0360543 3300046535 Unclassified 835
88 Ga0495622_0243277 3300046557 Bacteria 793
89 Ga0495625_0116264 3300046660 Bacteria 1824
90 Ga0495625_0229815 3300046660 Unclassified 1212
91 Ga0495588_0159020 3300046674 Bacteria 1195
92 Ga0495647_0640360 3300046681 Bacteria 500
93 Ga0495649_0511134 3300046694 Unclassified 597
94 Ga0495604_0496182 3300047317 Bacteria 792
95 Ga0495636_0106085 3300047318 Bacteria 1232
96 Ga0495674_1036850 3300047319 Bacteria 627
97 Ga0495674_1121511 3300047319 Unclassified 598
98 Ga0495684_0493748 3300047471 Bacteria 843
99 Ga0495602_0144647 3300048088 Bacteria 1878
100 Ga0496104_1213944 3300048907 Unclassified 657
101 Ga0496110_0790147 3300048913 Unclassified 853
102 Ga0496124_0172230 3300048927 Bacteria 1675
103 Ga0501032_0008159 3300049569 Bacteria 7638
104 Ga0501032_0904424 3300049569 Unclassified 556
105 Ga0501033_0002564 3300049570 Bacteria 15342
106 Ga0501033_0168656 3300049570 Bacteria 1573
107 Ga0501033_0538697 3300049570 Bacteria 805
108 Ga0501034_0762147 3300049571 Unclassified 863
109 Ga0501036_0193661 3300049572 Bacteria 1710
110 Ga0501037_0000424 3300049573 Bacteria 34932
111 Ga0501037_0795692 3300049573 Bacteria 624
112 Ga0501038_0527104 3300049574 Bacteria 901
113 Ga0501043_0000096 3300049579 Bacteria 79864
114 Ga0501043_0304563 3300049579 Bacteria 1217
115 Ga0501047_0044160 3300049581 Bacteria 4305
116 Ga0501047_0661767 3300049581 Bacteria 863
117 Ga0501067_0091876 3300049583 Bacteria 1685
118 Ga0501069_0000012 3300049585 Bacteria 148453
119 Ga0501069_0046652 3300049585 Bacteria 2404
120 Ga0501070_0000847 3300049586 Bacteria 27777
121 Ga0501070_0002212 3300049586 Bacteria 17074
122 Ga0501070_0144262 3300049586 Bacteria 1965
123 Ga0501071_0004974 3300049587 Bacteria 8489
124 Ga0501071_0111723 3300049587 Bacteria 2020
125 Ga0501072_0923839 3300049588 Bacteria 681
126 Ga0501073_0012730 3300049589 Bacteria 6137
127 Ga0501073_0103802 3300049589 Bacteria 1973
128 Ga0501074_0000018 3300049590 Bacteria 76326
129 Ga0501074_0087443 3300049590 Bacteria 2232
130 Ga0501076_0443898 3300049592 Bacteria 1068
131 Ga0501080_0001652 3300049742 Bacteria 18960
132 Ga0501080_0827439 3300049742 Unclassified 811
133 Ga0501081_0752681 3300049743 Bacteria 732
134 Ga0501083_0000575 3300049744 Bacteria 23551
135 Ga0501035_0000039 3300049822 Bacteria 156824
136 Ga0501035_0037875 3300049822 Bacteria 4365
137 Ga0501035_0042089 3300049822 Bacteria 4121
138 Ga0501035_0329275 3300049822 Bacteria 1282
139 Ga0501044_0000047 3300049823 Bacteria 146449
140 Ga0501044_0115188 3300049823 Bacteria 2693
141 Ga0501044_0208417 3300049823 Bacteria 1910
142 Ga0501044_0259879 3300049823 Bacteria 1675
143 nmdc:mga05p37_189092_c1 3300050507 Bacteria 1786
144 nmdc:mga05p37_559711_c1 3300050507 Bacteria 1299
145 nmdc:mga09592_605791_c1 3300050508 Unclassified 938
146 nmdc:mga0qj67_768757_c1 3300050509 Bacteria 764
147 nmdc:mga06r32_923503_c1 3300050510 Unclassified 828
148 Ga0495619_0195614 3300053085 Unclassified 1400
149 Ga0500578_0000282 3300053086 Bacteria 62821
150 Ga0500568_0037968 3300053139 Bacteria 1951
151 Ga0500577_0124453 3300053142 Bacteria 1075
152 Ga0500577_0276001 3300053142 Unclassified 732
153 Ga0500634_0024207 3300053161 Bacteria 3302
154 Ga0500609_031033 3300053731 Bacteria 734
155 Ga0501084_0307028 3300054114 Bacteria 1340
156 Ga0501082_1288411 3300060353 Bacteria 638
157 Ga0530510_0159356 3300061734 Bacteria 1669
158 Ga0530510_1493844 3300061734 Unclassified 519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585428062 2587760112 80
2 3300036401 Ga0373937_0200034 Ga0373937_0200034_1301_1546 81
3 3300046477 Ga0495664_0644488 Ga0495664_0644488_60_305 81
4 3300046529 Ga0495652_0270198 Ga0495652_0270198_193_438 81
5 3300046535 Ga0495586_0360543 Ga0495586_0360543_116_361 81
6 iso_pu_bacteria 2643221592 2643968365 81
7 iso_pu_bacteria 2643221625 2644141843 81
8 iso_pu_bacteria 2839993093 2839996464 81
9 iso_pu_bacteria 2928115317 2928116570 81
10 iso_pu_bacteria 8002060224 8002063910 81
11 3300005530 Ga0070679_100308964 Ga0070679_1003089642 83
12 3300025921 Ga0207652_10336620 Ga0207652_103366204 83
13 3300061734 Ga0530510_1493844 Ga0530510_1493844_56_310 83
14 3300006195 Ga0075366_10050746 Ga0075366_100507464 84
15 3300009177 Ga0105248_10450106 Ga0105248_104501062 84
16 3300014326 Ga0157380_10742823 Ga0157380_107428233 84
17 3300025298 Ga0209050_1008126 Ga0209050_10081269 84
18 3300025304 Ga0209257_1003311 Ga0209257_100331110 84
19 3300025941 Ga0207711_10571274 Ga0207711_105712742 84
20 3300030522 Ga0307512_10072194 Ga0307512_100721943 84
21 3300031730 Ga0307516_10713843 Ga0307516_107138432 84
22 3300033179 Ga0307507_10036865 Ga0307507_100368656 84
23 3300046660 Ga0495625_0116264 Ga0495625_0116264_624_878 84
24 3300049571 Ga0501034_0762147 Ga0501034_0762147_14_268 84
25 3300049742 Ga0501080_0827439 Ga0501080_0827439_372_626 84
26 3300053161 Ga0500634_0024207 Ga0500634_0024207_50_304 84
27 3300061734 Ga0530510_0159356 Ga0530510_0159356_435_689 84
28 3300005340 Ga0070689_100411743 Ga0070689_1004117432 85
29 3300005354 Ga0070675_101671556 Ga0070675_1016715562 85
30 3300005445 Ga0070708_100232538 Ga0070708_1002325381 85
31 3300005458 Ga0070681_10515504 Ga0070681_105155042 85
32 3300005466 Ga0070685_10550776 Ga0070685_105507762 85
33 3300005543 Ga0070672_100428258 Ga0070672_1004282582 85
34 3300005615 Ga0070702_101824217 Ga0070702_1018242171 85
35 3300005937 Ga0081455_10072039 Ga0081455_100720393 85
36 3300005985 Ga0081539_10019178 Ga0081539_100191782 85
37 3300006844 Ga0075428_100526735 Ga0075428_1005267353 85
38 3300006846 Ga0075430_100398588 Ga0075430_1003985882 85
39 3300006914 Ga0075436_101510642 Ga0075436_1015106422 85
40 3300007788 Ga0099795_10024663 Ga0099795_100246633 85
41 3300009147 Ga0114129_10062056 Ga0114129_100620563 85
42 3300009148 Ga0105243_11682263 Ga0105243_116822631 85
43 3300009176 Ga0105242_11257625 Ga0105242_112576252 85
44 3300013104 Ga0157370_11179341 Ga0157370_111793412 85
45 3300013308 Ga0157375_11254310 Ga0157375_112543102 85
46 3300014325 Ga0163163_11382939 Ga0163163_113829392 85
47 3300014326 Ga0157380_11711403 Ga0157380_117114032 85
48 3300021361 Ga0213872_10001675 Ga0213872_100016756 85
49 3300021361 Ga0213872_10313897 Ga0213872_103138971 85
50 3300021441 Ga0213871_10064193 Ga0213871_100641932 85
51 3300025934 Ga0207686_11165342 Ga0207686_111653421 85
52 3300025936 Ga0207670_10267753 Ga0207670_102677533 85
53 3300025937 Ga0207669_10912985 Ga0207669_109129852 85
54 3300028381 Ga0268264_11485293 Ga0268264_114852931 85
55 3300028577 Ga0265318_10156368 Ga0265318_101563682 85
56 3300031239 Ga0265328_10086717 Ga0265328_100867173 85
57 3300031247 Ga0265340_10013354 Ga0265340_100133543 85
58 3300031251 Ga0265327_10111603 Ga0265327_101116033 85
59 3300031507 Ga0307509_10834684 Ga0307509_108346842 85
60 3300031711 Ga0265314_10308815 Ga0265314_103088152 85
61 3300031712 Ga0265342_10146373 Ga0265342_101463733 85
62 3300035112 Ga0373932_0098145 Ga0373932_0098145_440_697 85
63 3300035115 Ga0373941_0122870 Ga0373941_0122870_174_431 85
64 3300035695 Ga0373927_0240226 Ga0373927_0240226_624_881 85
65 3300035695 Ga0373927_0308974 Ga0373927_0308974_612_869 85
66 3300035695 Ga0373927_0373487 Ga0373927_0373487_413_670 85
67 3300035695 Ga0373927_0481332 Ga0373927_0481332_421_678 85
68 3300035695 Ga0373927_0940951 Ga0373927_0940951_142_399 85
69 3300039438 Ga0436360_0600891 Ga0436360_0600891_1092_1349 85
70 3300039447 Ga0436361_0094673 Ga0436361_0094673_1336_1593 85
71 3300039453 Ga0436362_1053170 Ga0436362_1053170_299_556 85
72 3300042011 Ga0439454_096855 Ga0439454_096855_96_353 85
73 3300044684 Ga0466966_0291448 Ga0466966_0291448_192_449 85
74 3300044719 Ga0466971_0093512 Ga0466971_0093512_227_484 85
75 3300045049 Ga0466959_0916139 Ga0466959_0916139_232_489 85
76 3300045836 Ga0466958_0601357 Ga0466958_0601357_218_475 85
77 3300046454 Ga0495592_0538146 Ga0495592_0538146_259_516 85
78 3300046557 Ga0495622_0243277 Ga0495622_0243277_193_450 85
79 3300046660 Ga0495625_0229815 Ga0495625_0229815_745_1002 85
80 3300046674 Ga0495588_0159020 Ga0495588_0159020_39_296 85
81 3300046681 Ga0495647_0640360 Ga0495647_0640360_141_398 85
82 3300046694 Ga0495649_0511134 Ga0495649_0511134_123_380 85
83 3300047317 Ga0495604_0496182 Ga0495604_0496182_328_585 85
84 3300047318 Ga0495636_0106085 Ga0495636_0106085_710_967 85
85 3300047319 Ga0495674_1036850 Ga0495674_1036850_186_443 85
86 3300047319 Ga0495674_1121511 Ga0495674_1121511_69_326 85
87 3300047471 Ga0495684_0493748 Ga0495684_0493748_281_538 85
88 3300048088 Ga0495602_0144647 Ga0495602_0144647_333_596 85
89 3300048907 Ga0496104_1213944 Ga0496104_1213944_147_404 85
90 3300048927 Ga0496124_0172230 Ga0496124_0172230_1089_1346 85
91 3300049569 Ga0501032_0008159 Ga0501032_0008159_3039_3299 85
92 3300049569 Ga0501032_0904424 Ga0501032_0904424_245_505 85
93 3300049570 Ga0501033_0002564 Ga0501033_0002564_10946_11206 85
94 3300049570 Ga0501033_0168656 Ga0501033_0168656_580_840 85
95 3300049570 Ga0501033_0538697 Ga0501033_0538697_134_394 85
96 3300049572 Ga0501036_0193661 Ga0501036_0193661_307_567 85
97 3300049573 Ga0501037_0000424 Ga0501037_0000424_23168_23428 85
98 3300049573 Ga0501037_0795692 Ga0501037_0795692_160_420 85
99 3300049574 Ga0501038_0527104 Ga0501038_0527104_376_636 85
100 3300049579 Ga0501043_0000096 Ga0501043_0000096_56338_56598 85
101 3300049579 Ga0501043_0304563 Ga0501043_0304563_164_424 85
102 3300049581 Ga0501047_0044160 Ga0501047_0044160_3351_3611 85
103 3300049581 Ga0501047_0661767 Ga0501047_0661767_458_718 85
104 3300049583 Ga0501067_0091876 Ga0501067_0091876_1151_1411 85
105 3300049585 Ga0501069_0000012 Ga0501069_0000012_23267_23527 85
106 3300049585 Ga0501069_0046652 Ga0501069_0046652_1321_1581 85
107 3300049586 Ga0501070_0000847 Ga0501070_0000847_23259_23519 85
108 3300049586 Ga0501070_0002212 Ga0501070_0002212_9443_9703 85
109 3300049586 Ga0501070_0144262 Ga0501070_0144262_625_885 85
110 3300049587 Ga0501071_0004974 Ga0501071_0004974_2724_2984 85
111 3300049587 Ga0501071_0111723 Ga0501071_0111723_104_364 85
112 3300049588 Ga0501072_0923839 Ga0501072_0923839_14_271 85
113 3300049589 Ga0501073_0012730 Ga0501073_0012730_4366_4626 85
114 3300049589 Ga0501073_0103802 Ga0501073_0103802_450_710 85
115 3300049590 Ga0501074_0000018 Ga0501074_0000018_23267_23527 85
116 3300049590 Ga0501074_0087443 Ga0501074_0087443_740_1000 85
117 3300049592 Ga0501076_0443898 Ga0501076_0443898_90_350 85
118 3300049742 Ga0501080_0001652 Ga0501080_0001652_5069_5329 85
119 3300049744 Ga0501083_0000575 Ga0501083_0000575_15858_16118 85
120 3300049822 Ga0501035_0000039 Ga0501035_0000039_133214_133474 85
121 3300049822 Ga0501035_0037875 Ga0501035_0037875_2803_3063 85
122 3300049822 Ga0501035_0042089 Ga0501035_0042089_2708_2968 85
123 3300049822 Ga0501035_0329275 Ga0501035_0329275_973_1233 85
124 3300049823 Ga0501044_0000047 Ga0501044_0000047_23430_23690 85
125 3300049823 Ga0501044_0115188 Ga0501044_0115188_661_921 85
126 3300049823 Ga0501044_0208417 Ga0501044_0208417_539_799 85
127 3300049823 Ga0501044_0259879 Ga0501044_0259879_918_1178 85
128 3300050507 nmdc:mga05p37_189092_c1 nmdc:mga05p37_189092_c1_652_909 85
129 3300050510 nmdc:mga06r32_923503_c1 nmdc:mga06r32_923503_c1_340_597 85
130 3300053085 Ga0495619_0195614 Ga0495619_0195614_668_925 85
131 3300053086 Ga0500578_0000282 Ga0500578_0000282_60162_60419 85
132 3300053139 Ga0500568_0037968 Ga0500568_0037968_214_474 85
133 3300053142 Ga0500577_0124453 Ga0500577_0124453_669_926 85
134 3300053142 Ga0500577_0276001 Ga0500577_0276001_224_481 85
135 3300054114 Ga0501084_0307028 Ga0501084_0307028_951_1211 85
136 3300060353 Ga0501082_1288411 Ga0501082_1288411_301_561 85
137 3300039447 Ga0436361_0379549 Ga0436361_0379549_291_551 86
138 3300009148 Ga0105243_11163550 Ga0105243_111635502 87
139 3300037853 Ga0436364_1215350 Ga0436364_1215350_5789_6052 87
140 3300039437 Ga0436365_0431361 Ga0436365_0431361_85_348 87
141 3300025940 Ga0207691_10721996 Ga0207691_107219962 88
142 3300005530 Ga0070679_101067935 Ga0070679_1010679352 89
143 3300009177 Ga0105248_11821912 Ga0105248_118219121 89
144 3300010159 Ga0099796_10006788 Ga0099796_100067883 89
145 3300025941 Ga0207711_11915176 Ga0207711_119151762 89
146 3300039438 Ga0436360_0290779 Ga0436360_0290779_407_676 89
147 3300039450 Ga0436363_0009625 Ga0436363_0009625_398_667 89
148 3300039453 Ga0436362_1048807 Ga0436362_1048807_17_286 89
149 3300044712 Ga0453684_0000102 Ga0453684_0000102_52180_52449 89
150 3300053731 Ga0500609_031033 Ga0500609_031033_303_572 89
151 3300049743 Ga0501081_0752681 Ga0501081_0752681_35_310 91
152 3300005340 Ga0070689_100098720 Ga0070689_1000987204 95
153 3300005617 Ga0068859_102152323 Ga0068859_1021523231 95
154 3300006846 Ga0075430_100449385 Ga0075430_1004493852 95
155 3300006880 Ga0075429_100651475 Ga0075429_1006514752 95
156 3300006931 Ga0097620_102152447 Ga0097620_1021524472 95
157 3300009147 Ga0114129_10740139 Ga0114129_107401392 95
158 3300025315 Ga0207697_10116149 Ga0207697_101161492 95
159 3300025936 Ga0207670_10187057 Ga0207670_101870572 95
160 3300028381 Ga0268264_12275894 Ga0268264_122758941 95
161 3300048913 Ga0496110_0790147 Ga0496110_0790147_117_404 95
162 3300050507 nmdc:mga05p37_559711_c1 nmdc:mga05p37_559711_c1_214_501 95
163 3300050508 nmdc:mga09592_605791_c1 nmdc:mga09592_605791_c1_274_561 95
164 3300050509 nmdc:mga0qj67_768757_c1 nmdc:mga0qj67_768757_c1_13_300 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02604

PhdYeFM_antitox

Antitoxin Phd_YefM, type II toxin-antitoxin system

1

68

0.92

Feature Viewer

pLDDT pTM Quality
69.21 0.29 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map