F240654

General Info

Members Datasets Scaffolds Average Seq Length
163 85 326 139

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10218930|rootH2_102189303
Length 146
Sequence MKWVTWKNIGVDRMGSIWLIRRWIDPDAEFSFIPVGGKLLPEQGEPFDIPGTRYSHHGGHCTFYALLNQQSLQDPILKRIARLIDEADELQEITVEPAALGLDLICRGLRQISQDDFEAFERGSLIYDALYAQLKLDSTAAGTDGN

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
64 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
65 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
66 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
68 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
69 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
70 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
71 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
72 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
73 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
74 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
75 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
76 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
77 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
78 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
79 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
80 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
81 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
82 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
83 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
84 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
85 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.61
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 97.55
Stem 0
Stem Tuber 0
Unclassified 36.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10218930 3300003320 Bacteria 1951
2 SwRhRL3b_contig_1615539 2162886006 Unclassified 828
3 SwRhRL2b_contig_1004243 2162886007 Bacteria 3577
4 SwRhRL2b_contig_3374809 2162886007 Bacteria 3579
5 JGI25406J46586_10005358 3300003203 Bacteria 5952
6 JGI25406J46586_10100884 3300003203 Bacteria 861
7 Ga0065704_10000314 3300005289 Bacteria 38202
8 Ga0065704_10176508 3300005289 Bacteria 1261
9 Ga0065704_10263484 3300005289 Unclassified 960
10 Ga0065707_10081868 3300005295 Bacteria 32492
11 Ga0065707_10088563 3300005295 Bacteria 4623
12 Ga0065707_10208060 3300005295 Unclassified 1278
13 Ga0070689_100055754 3300005340 Bacteria 3063
14 Ga0070667_101267725 3300005367 Unclassified 690
15 Ga0070703_10044232 3300005406 Unclassified 1399
16 Ga0070705_100025603 3300005440 Unclassified 3200
17 Ga0070700_100076144 3300005441 Bacteria 2154
18 Ga0070694_100057647 3300005444 Unclassified 2641
19 Ga0070706_100038038 3300005467 Bacteria 4443
20 Ga0070706_100187271 3300005467 Unclassified 1934
21 Ga0070698_100015112 3300005471 Bacteria 8162
22 Ga0070698_100029806 3300005471 Bacteria 5662
23 Ga0070698_100089059 3300005471 Bacteria 3070
24 Ga0070698_100262235 3300005471 Unclassified 1660
25 Ga0070698_100663992 3300005471 Bacteria 984
26 Ga0070699_100004854 3300005518 Bacteria 11868
27 Ga0070699_100015636 3300005518 Bacteria 6518
28 Ga0070699_100047343 3300005518 Bacteria 3720
29 Ga0070699_100077950 3300005518 Unclassified 2885
30 Ga0070699_101824423 3300005518 Unclassified 557
31 Ga0070697_100660318 3300005536 Bacteria 921
32 Ga0068853_100125002 3300005539 Bacteria 2297
33 Ga0070695_100057321 3300005545 Unclassified 2516
34 Ga0070695_100724707 3300005545 Bacteria 791
35 Ga0070696_100029732 3300005546 Unclassified 3737
36 Ga0070696_100245918 3300005546 Bacteria 1351
37 Ga0070693_100754574 3300005547 Unclassified 717
38 Ga0070704_100044121 3300005549 Bacteria 3096
39 Ga0070704_100130006 3300005549 Bacteria 1950
40 Ga0070704_100309805 3300005549 Unclassified 1319
41 Ga0070704_100390390 3300005549 Bacteria 1185
42 Ga0070704_100676827 3300005549 Bacteria 913
43 Ga0070702_100160617 3300005615 Bacteria 1452
44 Ga0068859_100081539 3300005617 Bacteria 3277
45 Ga0068859_100527844 3300005617 Bacteria 1275
46 Ga0068861_100957949 3300005719 Bacteria 814
47 Ga0068863_100879196 3300005841 Bacteria 896
48 Ga0068862_100026568 3300005844 Bacteria 4867
49 Ga0081539_10001669 3300005985 Bacteria 35918
50 Ga0081539_10030147 3300005985 Bacteria 3373
51 Ga0075428_100046791 3300006844 Bacteria 4751
52 Ga0075428_100629448 3300006844 Bacteria 1145
53 Ga0075430_100301371 3300006846 Unclassified 1326
54 Ga0075431_100268484 3300006847 Unclassified 1730
55 Ga0075431_100326604 3300006847 Bacteria 1546
56 Ga0075431_100346243 3300006847 Bacteria 1495
57 Ga0075431_102209728 3300006847 Unclassified 504
58 Ga0075433_10367942 3300006852 Bacteria 1270
59 Ga0075433_10953227 3300006852 Bacteria 748
60 Ga0075433_11891516 3300006852 Unclassified 512
61 Ga0075429_100011619 3300006880 Bacteria 7637
62 Ga0075429_100028260 3300006880 Bacteria 4870
63 Ga0075429_100127471 3300006880 Bacteria 2226
64 Ga0075429_100251041 3300006880 Bacteria 1549
65 Ga0075429_100259957 3300006880 Unclassified 1520
66 Ga0075429_100376797 3300006880 Unclassified 1242
67 Ga0075429_100718527 3300006880 Bacteria 875
68 Ga0097620_100081539 3300006931 Bacteria 3277
69 Ga0097620_100527912 3300006931 Bacteria 1275
70 Ga0105240_10313133 3300009093 Bacteria 1792
71 Ga0114129_10013653 3300009147 Bacteria 11572
72 Ga0114129_10017488 3300009147 Bacteria 10209
73 Ga0114129_10211905 3300009147 Unclassified 2619
74 Ga0114129_10223376 3300009147 Bacteria 2540
75 Ga0114129_10572709 3300009147 Unclassified 1466
76 Ga0114129_10611352 3300009147 Bacteria 1411
77 Ga0105243_10563378 3300009148 Unclassified 1091
78 Ga0105243_11621825 3300009148 Unclassified 674
79 Ga0105238_10000106 3300009551 Bacteria 91792
80 Ga0105249_10162161 3300009553 Unclassified 2161
81 Ga0105249_10577291 3300009553 Unclassified 1177
82 Ga0157380_10942327 3300014326 Unclassified 893
83 Ga0206354_11696586 3300020081 Bacteria 680
84 Ga0207684_10398559 3300025910 Unclassified 1183
85 Ga0207694_10002492 3300025924 Bacteria 14981
86 Ga0207709_10015203 3300025935 Unclassified 4266
87 Ga0207712_10144904 3300025961 Unclassified 1827
88 Ga0207712_11825471 3300025961 Unclassified 545
89 Ga0207639_11293767 3300026041 Bacteria 684
90 Ga0207676_10079104 3300026095 Bacteria 2665
91 Ga0209968_1013198 3300027526 Bacteria 1294
92 Ga0209999_1016638 3300027543 Bacteria 1339
93 Ga0209966_1082593 3300027695 Bacteria 713
94 Ga0268265_10050095 3300028380 Bacteria 3145
95 Ga0268265_10779499 3300028380 Bacteria 930
96 Ga0268264_10476902 3300028381 Unclassified 1213
97 Ga0307408_100275543 3300031548 Unclassified 1399
98 Ga0307413_11038484 3300031824 Unclassified 705
99 Ga0307407_11054756 3300031903 Bacteria 630
100 Ga0307412_10716708 3300031911 Unclassified 860
101 Ga0307416_100208694 3300032002 Bacteria 1861
102 Ga0307415_100129837 3300032126 Bacteria 1905
103 Ga0451841_0448320 3300041498 Unclassified 582
104 Ga0451577_1977435 3300042876 Unclassified 510
105 Ga0453683_0121378 3300044673 Bacteria 1645
106 Ga0453683_0166434 3300044673 Unclassified 1396
107 Ga0453683_0273549 3300044673 Unclassified 1078
108 Ga0453683_0395089 3300044673 Unclassified 891
109 Ga0453684_0024623 3300044712 Bacteria 8785
110 Ga0453684_0093359 3300044712 Bacteria 3707
111 Ga0451576_0014560 3300045051 Bacteria 8742
112 Ga0451576_0017421 3300045051 Bacteria 7899
113 Ga0451576_0023621 3300045051 Bacteria 6655
114 Ga0451576_1031740 3300045051 Unclassified 862
115 Ga0451576_1172720 3300045051 Unclassified 803
116 Ga0451576_1636315 3300045051 Bacteria 667
117 Ga0495586_0431678 3300046535 Unclassified 759
118 Ga0496112_0886444 3300048915 Bacteria 815
119 Ga0501298_176555 3300049521 Unclassified 533
120 Ga0501039_0134279 3300049575 Bacteria 1943
121 Ga0501068_1130470 3300049584 Unclassified 518
122 Ga0501069_0371715 3300049585 Unclassified 844
123 Ga0501071_0374142 3300049587 Bacteria 1086
124 Ga0501072_0221246 3300049588 Unclassified 1509
125 Ga0501072_0699957 3300049588 Unclassified 796
126 Ga0501072_0749953 3300049588 Bacteria 766
127 Ga0501074_0525801 3300049590 Bacteria 838
128 Ga0501075_0085219 3300049591 Unclassified 2394
129 Ga0501075_0151315 3300049591 Bacteria 1769
130 Ga0501075_0227913 3300049591 Bacteria 1421
131 Ga0501076_0126259 3300049592 Bacteria 2073
132 Ga0501076_0213924 3300049592 Bacteria 1576
133 Ga0501076_0370503 3300049592 Unclassified 1177
134 Ga0501076_0419749 3300049592 Bacteria 1101
135 Ga0501198_065854 3300049649 Unclassified 674
136 Ga0501227_048392 3300049665 Bacteria 1068
137 Ga0501079_0388731 3300049741 Bacteria 1094
138 Ga0501081_0257330 3300049743 Bacteria 1275
139 Ga0501081_0855605 3300049743 Bacteria 685
140 nmdc:mga05p37_2061432_c1 3300050507 Unclassified 537
141 nmdc:mga05p37_441081_c1 3300050507 Bacteria 1510
142 nmdc:mga05p37_5260_c1 3300050507 Bacteria 15190
143 nmdc:mga05p37_775706_c1 3300050507 Bacteria 1053
144 nmdc:mga05p37_9757_c1 3300050507 Bacteria 11387
145 nmdc:mga09592_1153123_c1 3300050508 Unclassified 642
146 nmdc:mga09592_117738_c1 3300050508 Bacteria 2280
147 nmdc:mga09592_20189_c1 3300050508 Bacteria 5476
148 nmdc:mga09592_54500_c1 3300050508 Bacteria 3379
149 nmdc:mga09592_580775_c1 3300050508 Bacteria 961
150 nmdc:mga09592_61511_c1 3300050508 Bacteria 3176
151 nmdc:mga0qj67_1010876_c1 3300050509 Unclassified 652
152 nmdc:mga0qj67_206012_c1 3300050509 Bacteria 1597
153 nmdc:mga06r32_252447_c1 3300050510 Bacteria 1751
154 nmdc:mga06r32_298163_c1 3300050510 Unclassified 1598
155 nmdc:mga0a205_108475_c1 3300050515 Bacteria 2674
156 nmdc:mga0a205_1547531_c1 3300050515 Unclassified 511
157 nmdc:mga0a205_286292_c1 3300050515 Unclassified 1523
158 nmdc:mga0a205_303055_c1 3300050515 Bacteria 1470
159 Ga0501082_1051570 3300060353 Unclassified 712
160 Ga0501082_1393562 3300060353 Bacteria 612
161 Ga0530510_0356081 3300061734 Bacteria 1100
162 Ga0530510_0665836 3300061734 Bacteria 793
163 2687240374 2684623219 Bacteria 8442773
164 rootH2_10218930
165 SwRhRL3b_contig_1615539
166 SwRhRL2b_contig_1004243
167 SwRhRL2b_contig_3374809
168 JGI25406J46586_10005358
169 JGI25406J46586_10100884
170 Ga0065704_10000314
171 Ga0065704_10176508
172 Ga0065704_10263484
173 Ga0065707_10081868
174 Ga0065707_10088563
175 Ga0065707_10208060
176 Ga0070689_100055754
177 Ga0070667_101267725
178 Ga0070703_10044232
179 Ga0070705_100025603
180 Ga0070700_100076144
181 Ga0070694_100057647
182 Ga0070706_100038038
183 Ga0070706_100187271
184 Ga0070698_100015112
185 Ga0070698_100029806
186 Ga0070698_100089059
187 Ga0070698_100262235
188 Ga0070698_100663992
189 Ga0070699_100004854
190 Ga0070699_100015636
191 Ga0070699_100047343
192 Ga0070699_100077950
193 Ga0070699_101824423
194 Ga0070697_100660318
195 Ga0068853_100125002
196 Ga0070695_100057321
197 Ga0070695_100724707
198 Ga0070696_100029732
199 Ga0070696_100245918
200 Ga0070693_100754574
201 Ga0070704_100044121
202 Ga0070704_100130006
203 Ga0070704_100309805
204 Ga0070704_100390390
205 Ga0070704_100676827
206 Ga0070702_100160617
207 Ga0068859_100081539
208 Ga0068859_100527844
209 Ga0068861_100957949
210 Ga0068863_100879196
211 Ga0068862_100026568
212 Ga0081539_10001669
213 Ga0081539_10030147
214 Ga0075428_100046791
215 Ga0075428_100629448
216 Ga0075430_100301371
217 Ga0075431_100268484
218 Ga0075431_100326604
219 Ga0075431_100346243
220 Ga0075431_102209728
221 Ga0075433_10367942
222 Ga0075433_10953227
223 Ga0075433_11891516
224 Ga0075429_100011619
225 Ga0075429_100028260
226 Ga0075429_100127471
227 Ga0075429_100251041
228 Ga0075429_100259957
229 Ga0075429_100376797
230 Ga0075429_100718527
231 Ga0097620_100081539
232 Ga0097620_100527912
233 Ga0105240_10313133
234 Ga0114129_10013653
235 Ga0114129_10017488
236 Ga0114129_10211905
237 Ga0114129_10223376
238 Ga0114129_10572709
239 Ga0114129_10611352
240 Ga0105243_10563378
241 Ga0105243_11621825
242 Ga0105238_10000106
243 Ga0105249_10162161
244 Ga0105249_10577291
245 Ga0157380_10942327
246 Ga0206354_11696586
247 Ga0207684_10398559
248 Ga0207694_10002492
249 Ga0207709_10015203
250 Ga0207712_10144904
251 Ga0207712_11825471
252 Ga0207639_11293767
253 Ga0207676_10079104
254 Ga0209968_1013198
255 Ga0209999_1016638
256 Ga0209966_1082593
257 Ga0268265_10050095
258 Ga0268265_10779499
259 Ga0268264_10476902
260 Ga0307408_100275543
261 Ga0307413_11038484
262 Ga0307407_11054756
263 Ga0307412_10716708
264 Ga0307416_100208694
265 Ga0307415_100129837
266 Ga0451841_0448320
267 Ga0451577_1977435
268 Ga0453683_0121378
269 Ga0453683_0166434
270 Ga0453683_0273549
271 Ga0453683_0395089
272 Ga0453684_0024623
273 Ga0453684_0093359
274 Ga0451576_0014560
275 Ga0451576_0017421
276 Ga0451576_0023621
277 Ga0451576_1031740
278 Ga0451576_1172720
279 Ga0451576_1636315
280 Ga0495586_0431678
281 Ga0496112_0886444
282 Ga0501298_176555
283 Ga0501039_0134279
284 Ga0501068_1130470
285 Ga0501069_0371715
286 Ga0501071_0374142
287 Ga0501072_0221246
288 Ga0501072_0699957
289 Ga0501072_0749953
290 Ga0501074_0525801
291 Ga0501075_0085219
292 Ga0501075_0151315
293 Ga0501075_0227913
294 Ga0501076_0126259
295 Ga0501076_0213924
296 Ga0501076_0370503
297 Ga0501076_0419749
298 Ga0501198_065854
299 Ga0501227_048392
300 Ga0501079_0388731
301 Ga0501081_0257330
302 Ga0501081_0855605
303 nmdc:mga05p37_2061432_c1
304 nmdc:mga05p37_441081_c1
305 nmdc:mga05p37_5260_c1
306 nmdc:mga05p37_775706_c1
307 nmdc:mga05p37_9757_c1
308 nmdc:mga09592_1153123_c1
309 nmdc:mga09592_117738_c1
310 nmdc:mga09592_20189_c1
311 nmdc:mga09592_54500_c1
312 nmdc:mga09592_580775_c1
313 nmdc:mga09592_61511_c1
314 nmdc:mga0qj67_1010876_c1
315 nmdc:mga0qj67_206012_c1
316 nmdc:mga06r32_252447_c1
317 nmdc:mga06r32_298163_c1
318 nmdc:mga0a205_108475_c1
319 nmdc:mga0a205_1547531_c1
320 nmdc:mga0a205_286292_c1
321 nmdc:mga0a205_303055_c1
322 Ga0501082_1051570
323 Ga0501082_1393562
324 Ga0530510_0356081
325 Ga0530510_0665836
326 2687240374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09828

ChrB_C

ChrB, C-terminal domain

3

134

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ka0-assembly2.cif.gz_D silver-bound e.coli malate dehydrogenase 0.6301 1 32
2cmd-assembly1.cif.gz_A the crystal structure of e.coli malate dehydrogenase: a complex of the apoenzyme and citrate at 1.87 angstroms resolution 0.6234 1 32
3hhp-assembly2.cif.gz_D malate dehydrogenase open conformation 0.621 1 32
1ib6-assembly1.cif.gz_B crystal structure of r153c e. coli malate dehydrogenase 0.6186 1 32
5z3w-assembly2.cif.gz_B malate dehydrogenase binds silver at c113 0.6158 1 32
ID Description Score Start End Superfamily
3tmgB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5924 1 35 3.40.190.10
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.5536 10 34 3.40.30.10
1u5wH00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.5369 2 34 3.90.950.10
1korA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5093 1 45 3.40.50.620
af_K7UT64_31_110_1.10.246.20 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain 0.5047 70 139 1.10.246.20
ID Description Score Start End GO Terms
AF-A0A497LDA8-F1-model_v4 Chromate resistance protein 0.9672 2 135
AF-A0A497F5K0-F1-model_v4 Chromate resistance protein 0.9618 1 132
AF-A0A292YNU7-F1-model_v4 ChrB C-terminal domain-containing protein 0.9578 1 140
AF-A0A3A4T4Z2-F1-model_v4 ChrB C-terminal domain-containing protein 0.9547 1 138
AF-A0A292YNU7-F1-model_v4 ChrB C-terminal domain-containing protein 0.9511 1 140

Map