F239808

General Info

Members Datasets Scaffolds Average Seq Length
162 111 155 302

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0036216|Ga0436364_0036216_3850_4827
Length 325
Sequence MILRPAAKAGAWRAMPLPPEKRRSTMALTKRTLGRTGLEVTDLSYGAMEIRGPRIWGGRSLEDSQAEAILNAVLDSGVNFIDTANDYGRSEEFIGRYISRRRDEFYIATKCGCTVVRRDEHTDDTPHVWTRENLFRGLHESLERMKTDHVDVMQLHNPSVEQAEQGDLVAVLQEMKQQGKVRWIGCSSTHPHIETYIRWGVFDVFQIPYSALERQHEEAIAQAAQAGAGTIIRGGVARGEPGVGLGNDDRWAQFERAKLDELRAEGESRTAFLLRFTLSHPDMDTTIVGTLIPEHLRENVRIAEQGPLPADVYAEAKRRLDAATS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2857472729 Cohnella sp. R-74144 Isolate Unclassified
3 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
4 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
5 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
55 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
76 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
86 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
87 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
111 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 0
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 0
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2520507 2162886007 Bacteria 3098
2 JGI25406J46586_10010058 3300003203 Bacteria 4213
3 JGI25406J46586_10011266 3300003203 Bacteria 3928
4 Ga0065704_10000951 3300005289 Bacteria 21531
5 Ga0065704_10085466 3300005289 Unclassified 3219
6 Ga0065707_10000757 3300005295 Bacteria 20925
7 Ga0065707_10083744 3300005295 Bacteria 8338
8 Ga0065707_10092737 3300005295 Bacteria 3726
9 Ga0070658_10002438 3300005327 Bacteria 15565
10 Ga0070658_10010806 3300005327 Bacteria 7318
11 Ga0070660_100004911 3300005339 Bacteria 9246
12 Ga0070689_100271433 3300005340 Unclassified 1404
13 Ga0070675_100452041 3300005354 Bacteria 1152
14 Ga0070701_10281961 3300005438 Unclassified 1015
15 Ga0070694_100035873 3300005444 Unclassified 3281
16 Ga0070694_100087722 3300005444 Bacteria 2177
17 Ga0070685_10068866 3300005466 Bacteria 2091
18 Ga0070707_100389832 3300005468 Bacteria 1353
19 Ga0070698_100034680 3300005471 Bacteria 5221
20 Ga0070698_100082691 3300005471 Unclassified 3203
21 Ga0070698_100375266 3300005471 Unclassified 1355
22 Ga0070684_100088016 3300005535 Bacteria 2758
23 Ga0068853_100073969 3300005539 Bacteria 2972
24 Ga0068853_100126280 3300005539 Bacteria 2285
25 Ga0070695_100048739 3300005545 Unclassified 2710
26 Ga0070695_100062743 3300005545 Unclassified 2414
27 Ga0070704_100068326 3300005549 Unclassified 2570
28 Ga0068855_100014609 3300005563 Bacteria 9457
29 Ga0068855_100557437 3300005563 Bacteria 1240
30 Ga0070702_100177687 3300005615 Bacteria 1390
31 Ga0068852_100022643 3300005616 Bacteria 5043
32 Ga0068851_10003993 3300005834 Bacteria 6619
33 Ga0081455_10009825 3300005937 Bacteria 9800
34 Ga0081455_10011032 3300005937 Bacteria 9101
35 Ga0081455_10063797 3300005937 Bacteria 3089
36 Ga0081539_10000015 3300005985 Bacteria 395781
37 Ga0081539_10016884 3300005985 Bacteria 5176
38 Ga0081539_10103801 3300005985 Bacteria 1444
39 Ga0075428_100282810 3300006844 Bacteria 1785
40 Ga0075428_100411038 3300006844 Unclassified 1450
41 Ga0075431_100420457 3300006847 Bacteria 1336
42 Ga0075433_10214840 3300006852 Bacteria 1709
43 Ga0075433_10310260 3300006852 Bacteria 1396
44 Ga0075433_10322266 3300006852 Bacteria 1367
45 Ga0075434_100397650 3300006871 Bacteria 1399
46 Ga0075429_100007967 3300006880 Bacteria 9202
47 Ga0075429_100100171 3300006880 Bacteria 2528
48 Ga0105240_10000859 3300009093 Bacteria 54758
49 Ga0111539_10072581 3300009094 Bacteria 4059
50 Ga0111539_10107949 3300009094 Unclassified 3266
51 Ga0114129_10006655 3300009147 Bacteria 16408
52 Ga0114129_10765808 3300009147 Bacteria 1234
53 Ga0114129_10778746 3300009147 Unclassified 1222
54 Ga0105243_10067403 3300009148 Unclassified 2881
55 Ga0105237_10000032 3300009545 Bacteria 197324
56 Ga0105239_10014439 3300010375 Bacteria 8766
57 Ga0105239_10017249 3300010375 Bacteria 7984
58 Ga0105239_10525926 3300010375 Unclassified 1346
59 Ga0105246_10107298 3300011119 Bacteria 2045
60 Ga0157374_10010699 3300013296 Bacteria 7903
61 Ga0157374_10475546 3300013296 Bacteria 1252
62 Ga0213875_10000257 3300021388 Bacteria 53496
63 Ga0213875_10012100 3300021388 Bacteria 4269
64 Ga0209566_100284 3300025225 Bacteria 46586
65 Ga0207705_10003806 3300025909 Bacteria 11473
66 Ga0207705_10017065 3300025909 Bacteria 5200
67 Ga0207695_10001410 3300025913 Bacteria 40494
68 Ga0207671_10000231 3300025914 Bacteria 84347
69 Ga0207662_10226852 3300025918 Bacteria 1218
70 Ga0207657_10209748 3300025919 Unclassified 1564
71 Ga0207646_10356837 3300025922 Bacteria 1321
72 Ga0207709_10114065 3300025935 Bacteria 1813
73 Ga0207667_10001594 3300025949 Bacteria 28505
74 Ga0207667_10149764 3300025949 Bacteria 2402
75 Ga0207712_10129027 3300025961 Unclassified 1924
76 Ga0207641_10420578 3300026088 Bacteria 1287
77 Ga0268265_10196080 3300028380 Unclassified 1748
78 Ga0265323_10073852 3300028653 Unclassified 1161
79 Ga0265322_10007204 3300028654 Unclassified 3257
80 Ga0265338_10007779 3300028800 Bacteria 13183
81 Ga0265320_10025877 3300031240 Unclassified 3079
82 Ga0265329_10039610 3300031242 Bacteria 1514
83 Ga0265316_10000056 3300031344 Bacteria 121489
84 Ga0265316_10134769 3300031344 Bacteria 1858
85 Ga0307408_100129154 3300031548 Bacteria 1969
86 Ga0265314_10002633 3300031711 Bacteria 18095
87 Ga0265342_10000094 3300031712 Bacteria 97610
88 Ga0316578_10065695 3300031728 Bacteria 2142
89 Ga0316577_10224787 3300031733 Bacteria 1061
90 Ga0307413_10025616 3300031824 Bacteria 3236
91 Ga0307410_10125781 3300031852 Bacteria 1876
92 Ga0307407_10009879 3300031903 Bacteria 4467
93 Ga0307416_100033167 3300032002 Bacteria 3911
94 Ga0307411_10024629 3300032005 Bacteria 3590
95 Ga0316574_0105241 3300035398 Unclassified 1807
96 Ga0395899_0023405 3300037312 Bacteria 4678
97 Ga0395899_0041615 3300037312 Bacteria 3433
98 Ga0395899_0051011 3300037312 Unclassified 3071
99 Ga0395905_0000594 3300037471 Bacteria 48383
100 Ga0436364_0036216 3300037853 Bacteria 17573
101 Ga0436364_0085187 3300037853 Bacteria 197036
102 Ga0436363_1344984 3300039450 Bacteria 1329
103 Ga0439439_0027361 3300041406 Bacteria 1441
104 Ga0439462_0026597 3300042015 Bacteria 1525
105 Ga0451577_0069369 3300042876 Bacteria 3144
106 Ga0451577_0125564 3300042876 Bacteria 2299
107 Ga0451577_0245896 3300042876 Bacteria 1619
108 Ga0451577_0457757 3300042876 Bacteria 1159
109 Ga0439440_0034173 3300042993 Unclassified 1215
110 Ga0466965_0008964 3300044683 Bacteria 4638
111 Ga0453684_0000581 3300044712 Bacteria 136088
112 Ga0453684_0002452 3300044712 Bacteria 45012
113 Ga0453684_0179414 3300044712 Bacteria 2487
114 Ga0453684_0352693 3300044712 Bacteria 1658
115 Ga0453684_0415400 3300044712 Bacteria 1504
116 Ga0453684_0526814 3300044712 Unclassified 1305
117 Ga0453684_0833666 3300044712 Bacteria 992
118 Ga0453684_0969070 3300044712 Unclassified 906
119 Ga0466970_0025893 3300044765 Bacteria 3073
120 Ga0466970_0093754 3300044765 Bacteria 1631
121 Ga0466960_0027016 3300044901 Bacteria 2614
122 Ga0451576_0025676 3300045051 Bacteria 6345
123 Ga0451576_0037872 3300045051 Bacteria 5106
124 Ga0495656_0124215 3300046615 Bacteria 1222
125 Ga0496116_0023217 3300048919 Bacteria 4625
126 Ga0496116_0071635 3300048919 Bacteria 2194
127 Ga0496119_0002374 3300048922 Bacteria 20694
128 Ga0496122_0004997 3300048925 Bacteria 16045
129 Ga0501031_0000219 3300049568 Bacteria 32918
130 Ga0501032_0000511 3300049569 Bacteria 31527
131 Ga0501033_0022833 3300049570 Bacteria 4716
132 Ga0501034_0006710 3300049571 Bacteria 12341
133 Ga0501036_0001219 3300049572 Bacteria 19669
134 Ga0501037_0001162 3300049573 Bacteria 19438
135 Ga0501038_0001219 3300049574 Bacteria 23317
136 Ga0501039_0000544 3300049575 Bacteria 27296
137 Ga0501043_0007190 3300049579 Bacteria 8845
138 Ga0501046_0000409 3300049580 Bacteria 42723
139 Ga0501048_0001934 3300049582 Bacteria 15732
140 Ga0501067_0021210 3300049583 Bacteria 3594
141 Ga0501069_0001478 3300049585 Bacteria 11580
142 Ga0501070_0000814 3300049586 Bacteria 28341
143 Ga0501073_0001154 3300049589 Bacteria 19252
144 Ga0501035_0017798 3300049822 Bacteria 6554
145 Ga0501044_0006945 3300049823 Bacteria 12459
146 nmdc:mga05p37_14881_c1 3300050507 Bacteria 9344
147 nmdc:mga05p37_3339_c1 3300050507 Bacteria 16107
148 nmdc:mga09592_14661_c1 3300050508 Bacteria 6396
149 nmdc:mga09592_208902_c1 3300050508 Unclassified 1691
150 nmdc:mga09592_69075_c1 3300050508 Bacteria 2997
151 nmdc:mga08y16_58105_c1 3300050511 Bacteria 4041
152 nmdc:mga08y16_90751_c1 3300050511 Bacteria 3185
153 nmdc:mga0a205_304263_c1 3300050515 Bacteria 1467
154 nmdc:mga0a205_96427_c1 3300050515 Unclassified 2856
155 Ga0501084_0008728 3300054114 Bacteria 8383

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041406 Ga0439439_0027361 Ga0439439_0027361_67_840 257
2 3300042876 Ga0451577_0245896 Ga0451577_0245896_313_1221 267
3 3300045051 Ga0451576_0025676 Ga0451576_0025676_341_1249 267
4 3300009094 Ga0111539_10072581 Ga0111539_100725817 274
5 3300050511 nmdc:mga08y16_58105_c1 nmdc:mga08y16_58105_c1_235_1065 274
6 3300005539 Ga0068853_100073969 Ga0068853_1000739695 275
7 3300028800 Ga0265338_10007779 Ga0265338_100077792 275
8 3300031240 Ga0265320_10025877 Ga0265320_100258771 275
9 3300031242 Ga0265329_10039610 Ga0265329_100396102 275
10 3300031344 Ga0265316_10134769 Ga0265316_101347692 275
11 3300005327 Ga0070658_10010806 Ga0070658_100108066 276
12 3300005339 Ga0070660_100004911 Ga0070660_10000491111 276
13 3300005834 Ga0068851_10003993 Ga0068851_100039935 276
14 3300009093 Ga0105240_10000859 Ga0105240_100008591 276
15 3300025909 Ga0207705_10003806 Ga0207705_100038068 276
16 3300025913 Ga0207695_10001410 Ga0207695_100014101 276
17 3300025919 Ga0207657_10209748 Ga0207657_102097482 276
18 3300037471 Ga0395905_0000594 Ga0395905_0000594_7633_8538 276
19 3300013296 Ga0157374_10010699 Ga0157374_100106998 277
20 3300044683 Ga0466965_0008964 Ga0466965_0008964_2625_3533 277
21 3300044765 Ga0466970_0025893 Ga0466970_0025893_99_1007 277
22 3300044765 Ga0466970_0093754 Ga0466970_0093754_416_1324 277
23 3300044901 Ga0466960_0027016 Ga0466960_0027016_591_1499 277
24 3300005354 Ga0070675_100452041 Ga0070675_1004520411 278
25 3300005466 Ga0070685_10068866 Ga0070685_100688663 278
26 3300005535 Ga0070684_100088016 Ga0070684_1000880163 278
27 3300005937 Ga0081455_10009825 Ga0081455_100098254 278
28 3300005937 Ga0081455_10011032 Ga0081455_100110325 278
29 3300005937 Ga0081455_10063797 Ga0081455_100637972 278
30 3300009147 Ga0114129_10765808 Ga0114129_107658082 278
31 3300010375 Ga0105239_10525926 Ga0105239_105259261 278
32 3300013296 Ga0157374_10475546 Ga0157374_104755462 278
33 3300021388 Ga0213875_10000257 Ga0213875_1000025738 278
34 3300021388 Ga0213875_10012100 Ga0213875_100121002 278
35 3300025961 Ga0207712_10129027 Ga0207712_101290272 278
36 3300026088 Ga0207641_10420578 Ga0207641_104205781 278
37 3300037853 Ga0436364_0036216 Ga0436364_0036216_3850_4827 278
38 3300037853 Ga0436364_0085187 Ga0436364_0085187_47867_48796 278
39 3300039450 Ga0436363_1344984 Ga0436363_1344984_346_1248 278
40 3300048925 Ga0496122_0004997 Ga0496122_0004997_11564_12460 278
41 3300003203 JGI25406J46586_10010058 JGI25406J46586_100100586 279
42 3300005539 Ga0068853_100126280 Ga0068853_1001262802 279
43 3300005985 Ga0081539_10000015 Ga0081539_1000001565 279
44 3300005985 Ga0081539_10103801 Ga0081539_101038012 279
45 3300009545 Ga0105237_10000032 Ga0105237_1000003256 279
46 3300010375 Ga0105239_10014439 Ga0105239_100144396 279
47 3300025914 Ga0207671_10000231 Ga0207671_1000023118 279
48 3300031548 Ga0307408_100129154 Ga0307408_1001291543 279
49 3300031824 Ga0307413_10025616 Ga0307413_100256163 279
50 3300031852 Ga0307410_10125781 Ga0307410_101257812 279
51 3300031903 Ga0307407_10009879 Ga0307407_100098793 279
52 3300032002 Ga0307416_100033167 Ga0307416_1000331674 279
53 3300032005 Ga0307411_10024629 Ga0307411_100246293 279
54 3300037312 Ga0395899_0023405 Ga0395899_0023405_2388_3302 279
55 3300042015 Ga0439462_0026597 Ga0439462_0026597_334_1233 279
56 3300042993 Ga0439440_0034173 Ga0439440_0034173_335_1201 279
57 3300046615 Ga0495656_0124215 Ga0495656_0124215_38_952 279
58 3300006844 Ga0075428_100282810 Ga0075428_1002828102 280
59 3300037312 Ga0395899_0041615 Ga0395899_0041615_1107_2015 280
60 3300049568 Ga0501031_0000219 Ga0501031_0000219_10168_11097 280
61 3300049569 Ga0501032_0000511 Ga0501032_0000511_3183_4112 280
62 3300049570 Ga0501033_0022833 Ga0501033_0022833_178_1107 280
63 3300049571 Ga0501034_0006710 Ga0501034_0006710_9041_9970 280
64 3300049572 Ga0501036_0001219 Ga0501036_0001219_18813_19655 280
65 3300049573 Ga0501037_0001162 Ga0501037_0001162_9041_9970 280
66 3300049574 Ga0501038_0001219 Ga0501038_0001219_18539_19468 280
67 3300049575 Ga0501039_0000544 Ga0501039_0000544_25093_26022 280
68 3300049579 Ga0501043_0007190 Ga0501043_0007190_5545_6474 280
69 3300049580 Ga0501046_0000409 Ga0501046_0000409_22853_23782 280
70 3300049582 Ga0501048_0001934 Ga0501048_0001934_11098_12027 280
71 3300049583 Ga0501067_0021210 Ga0501067_0021210_2253_3182 280
72 3300049585 Ga0501069_0001478 Ga0501069_0001478_2615_3544 280
73 3300049586 Ga0501070_0000814 Ga0501070_0000814_17944_18873 280
74 3300049589 Ga0501073_0001154 Ga0501073_0001154_18060_18989 280
75 3300049822 Ga0501035_0017798 Ga0501035_0017798_3254_4183 280
76 3300049823 Ga0501044_0006945 Ga0501044_0006945_9169_10098 280
77 3300054114 Ga0501084_0008728 Ga0501084_0008728_3270_4199 280
78 3300005563 Ga0068855_100014609 Ga0068855_1000146098 281
79 3300005563 Ga0068855_100557437 Ga0068855_1005574371 281
80 3300009094 Ga0111539_10107949 Ga0111539_101079494 281
81 3300025949 Ga0207667_10001594 Ga0207667_1000159420 281
82 3300028654 Ga0265322_10007204 Ga0265322_100072042 281
83 3300031344 Ga0265316_10000056 Ga0265316_1000005689 281
84 3300031712 Ga0265342_10000094 Ga0265342_1000009481 281
85 3300037312 Ga0395899_0051011 Ga0395899_0051011_1587_2492 281
86 3300042876 Ga0451577_0457757 Ga0451577_0457757_73_918 281
87 3300044712 Ga0453684_0526814 Ga0453684_0526814_102_1022 281
88 3300044712 Ga0453684_0969070 Ga0453684_0969070_26_871 281
89 3300048919 Ga0496116_0023217 Ga0496116_0023217_3052_3960 281
90 3300048919 Ga0496116_0071635 Ga0496116_0071635_1071_2003 281
91 3300050511 nmdc:mga08y16_90751_c1 nmdc:mga08y16_90751_c1_427_1272 281
92 iso_pu_bacteria 2857472729 2857478564 281
93 iso_pu_bacteria 2888578766 2888581651 281
94 iso_pu_bacteria 2889049205 2889054623 281
95 3300005327 Ga0070658_10002438 Ga0070658_1000243811 282
96 3300005616 Ga0068852_100022643 Ga0068852_1000226432 282
97 3300010375 Ga0105239_10017249 Ga0105239_100172495 282
98 3300025225 Ga0209566_100284 Ga0209566_10028438 282
99 3300025909 Ga0207705_10017065 Ga0207705_100170656 282
100 3300025949 Ga0207667_10149764 Ga0207667_101497642 282
101 3300031711 Ga0265314_10002633 Ga0265314_100026336 282
102 3300031728 Ga0316578_10065695 Ga0316578_100656951 282
103 3300031733 Ga0316577_10224787 Ga0316577_102247872 282
104 3300035398 Ga0316574_0105241 Ga0316574_0105241_915_1763 282
105 3300044712 Ga0453684_0000581 Ga0453684_0000581_123889_124803 282
106 3300044712 Ga0453684_0002452 Ga0453684_0002452_18643_19557 282
107 3300048922 Ga0496119_0002374 Ga0496119_0002374_17184_18104 282
108 iso_pu_bacteria 8002317523 8002319978 282
109 iso_pu_bacteria 8046991243 8046998048 282
110 3300028653 Ga0265323_10073852 Ga0265323_100738521 283
111 3300042876 Ga0451577_0069369 Ga0451577_0069369_248_1171 283
112 3300044712 Ga0453684_0352693 Ga0453684_0352693_488_1411 283
113 iso_pu_bacteria 2889049205 2889053730 283
114 iso_pu_bacteria 2919425241 2919426446 283
115 2162886007 SwRhRL2b_contig_2520507 SwRhRL2b_0975.00004680 284
116 3300003203 JGI25406J46586_10011266 JGI25406J46586_100112663 284
117 3300005289 Ga0065704_10000951 Ga0065704_1000095118 284
118 3300005289 Ga0065704_10085466 Ga0065704_100854663 284
119 3300005295 Ga0065707_10000757 Ga0065707_1000075718 284
120 3300005295 Ga0065707_10083744 Ga0065707_100837444 284
121 3300005295 Ga0065707_10092737 Ga0065707_100927373 284
122 3300005340 Ga0070689_100271433 Ga0070689_1002714332 284
123 3300005438 Ga0070701_10281961 Ga0070701_102819611 284
124 3300005444 Ga0070694_100035873 Ga0070694_1000358732 284
125 3300005444 Ga0070694_100087722 Ga0070694_1000877222 284
126 3300005468 Ga0070707_100389832 Ga0070707_1003898321 284
127 3300005471 Ga0070698_100034680 Ga0070698_1000346804 284
128 3300005471 Ga0070698_100082691 Ga0070698_1000826914 284
129 3300005471 Ga0070698_100375266 Ga0070698_1003752661 284
130 3300005545 Ga0070695_100048739 Ga0070695_1000487393 284
131 3300005545 Ga0070695_100062743 Ga0070695_1000627432 284
132 3300005549 Ga0070704_100068326 Ga0070704_1000683262 284
133 3300005615 Ga0070702_100177687 Ga0070702_1001776872 284
134 3300005985 Ga0081539_10016884 Ga0081539_100168843 284
135 3300006844 Ga0075428_100411038 Ga0075428_1004110381 284
136 3300006847 Ga0075431_100420457 Ga0075431_1004204572 284
137 3300006852 Ga0075433_10214840 Ga0075433_102148402 284
138 3300006852 Ga0075433_10310260 Ga0075433_103102602 284
139 3300006852 Ga0075433_10322266 Ga0075433_103222662 284
140 3300006871 Ga0075434_100397650 Ga0075434_1003976501 284
141 3300006880 Ga0075429_100007967 Ga0075429_1000079676 284
142 3300006880 Ga0075429_100100171 Ga0075429_1001001712 284
143 3300009147 Ga0114129_10006655 Ga0114129_1000665514 284
144 3300009147 Ga0114129_10778746 Ga0114129_107787461 284
145 3300009148 Ga0105243_10067403 Ga0105243_100674034 284
146 3300011119 Ga0105246_10107298 Ga0105246_101072982 284
147 3300025918 Ga0207662_10226852 Ga0207662_102268522 284
148 3300025922 Ga0207646_10356837 Ga0207646_103568372 284
149 3300025935 Ga0207709_10114065 Ga0207709_101140652 284
150 3300028380 Ga0268265_10196080 Ga0268265_101960802 284
151 3300042876 Ga0451577_0125564 Ga0451577_0125564_590_1444 284
152 3300044712 Ga0453684_0179414 Ga0453684_0179414_141_995 284
153 3300044712 Ga0453684_0415400 Ga0453684_0415400_36_890 284
154 3300044712 Ga0453684_0833666 Ga0453684_0833666_50_904 284
155 3300045051 Ga0451576_0037872 Ga0451576_0037872_2938_3792 284
156 3300050507 nmdc:mga05p37_14881_c1 nmdc:mga05p37_14881_c1_973_1827 284
157 3300050507 nmdc:mga05p37_3339_c1 nmdc:mga05p37_3339_c1_13573_14427 284
158 3300050508 nmdc:mga09592_14661_c1 nmdc:mga09592_14661_c1_4550_5404 284
159 3300050508 nmdc:mga09592_208902_c1 nmdc:mga09592_208902_c1_68_922 284
160 3300050508 nmdc:mga09592_69075_c1 nmdc:mga09592_69075_c1_654_1508 284
161 3300050515 nmdc:mga0a205_304263_c1 nmdc:mga0a205_304263_c1_173_1027 284
162 3300050515 nmdc:mga0a205_96427_c1 nmdc:mga0a205_96427_c1_76_930 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

42

320

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exa-assembly2.cif.gz_F crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8867 9 258
4exb-assembly3.cif.gz_E putative aldo-keto reductase from pseudomona aeruginosa 0.8862 14 258
4exb-assembly1.cif.gz_B putative aldo-keto reductase from pseudomona aeruginosa 0.8854 14 258
4exb-assembly1.cif.gz_A putative aldo-keto reductase from pseudomona aeruginosa 0.8826 14 258
4exa-assembly1.cif.gz_A crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8794 11 258
ID Description Score Start End Superfamily
4exaF00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8867 9 258 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8508 13 272 3.20.20.100
af_Q2FY71_1_289_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8328 15 269 3.20.20.100
af_Q9VGF2_1_211_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8299 14 162 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8063 4 272 3.20.20.100
ID Description Score Start End GO Terms
AF-S0EYN5-F1-model_v4 Predicted oxidoreductases (Related to aryl-alcohol dehydrogenases) 0.957 3 280
AF-A0A517ZRM4-F1-model_v4 General stress protein 69 (EC 1.1.1.-) 0.9512 4 277 GO:0016491
AF-A0A353BCM6-F1-model_v4 Aldo/keto reductase 0.9505 3 276
AF-A0A382WCZ3-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9464 102 275
AF-A0A2V7A4N2-F1-model_v4 Aldo/keto reductase 0.9456 83 280

Feature Viewer

pLDDT pTM Quality
87.77 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map