F239200

General Info

Members Datasets Scaffolds Average Seq Length
162 119 324 210

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11497259|Ga0105248_114972591
Length 221
Sequence MFRGCLEREAALELVIGTKKWSTWSMRPWLVLKRAGVAFEETLVELRQETRSHAEIARHSPSGMVPVLKDGDLVLWDSLAICEYLAERFPEAKLWPDDPAKRALGRAAAAEMHSGFASLRGECPMALEAPVRAVELSPLTQANIRRIVDLWSGLIERFGGPFLVGEWSIADAYYTPVATRLRTYGVHLSDYGDAGAAGGYCARLLSTPEYRAWEKDALAAV

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
28 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
43 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
49 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
50 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
51 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
52 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
61 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
65 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
66 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
67 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
68 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
69 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
70 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
71 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
74 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
75 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
76 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
77 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
80 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
81 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
92 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
93 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
94 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
95 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
96 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
97 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
98 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
99 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
100 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
101 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
102 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
103 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
104 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
105 2643221583 Caulobacter sp. Root655 Isolate Unclassified
106 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
107 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
108 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
109 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
110 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
111 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
112 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
113 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
114 2849560528 Caulobacter zeae 410 Isolate Unclassified
115 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
116 2851153111 Caulobacter radicis 736 Isolate Unclassified
117 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
118 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
119 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.04
Metatranscriptomes 0
Isolates 12.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.41
Nodule 0
Rhizoplane 1.85
Rhizosphere 72.84
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_11497259 3300009177 Bacteria 764
2 Ga0070670_100000269 3300005331 Bacteria 46231
3 Ga0070670_100037907 3300005331 Bacteria 4146
4 Ga0070666_10079287 3300005335 Bacteria 2243
5 Ga0070668_100006151 3300005347 Bacteria 8893
6 Ga0070668_100006159 3300005347 Bacteria 8887
7 Ga0070669_100026556 3300005353 Bacteria 4166
8 Ga0070671_100028343 3300005355 Bacteria 4611
9 Ga0070659_100026952 3300005366 Bacteria 4424
10 Ga0070667_100402292 3300005367 Bacteria 1246
11 Ga0068853_100044140 3300005539 Bacteria 3816
12 Ga0070665_100029258 3300005548 Bacteria 5545
13 Ga0070664_100013170 3300005564 Bacteria 6734
14 Ga0068852_100672534 3300005616 Bacteria 1044
15 Ga0068859_100003944 3300005617 Bacteria 15150
16 Ga0068864_100093916 3300005618 Bacteria 2650
17 Ga0068863_100084137 3300005841 Bacteria 3015
18 Ga0068860_100000032 3300005843 Bacteria 251624
19 Ga0068860_100005854 3300005843 Bacteria 12375
20 Ga0068860_100456947 3300005843 Bacteria 1270
21 Ga0068862_100001662 3300005844 Bacteria 20203
22 Ga0068862_100009972 3300005844 Bacteria 7848
23 Ga0068862_100137025 3300005844 Bacteria 2170
24 Ga0070712_100687960 3300006175 Bacteria 871
25 Ga0075366_10068581 3300006195 Bacteria 2110
26 Ga0097620_100003944 3300006931 Bacteria 15150
27 Ga0105240_10005291 3300009093 Bacteria 19267
28 Ga0105240_10026364 3300009093 Bacteria 7625
29 Ga0111539_10572427 3300009094 Bacteria 1316
30 Ga0105241_10064498 3300009174 Bacteria 2828
31 Ga0105248_10027705 3300009177 Bacteria 6310
32 Ga0105238_10030360 3300009551 Bacteria 5501
33 Ga0105238_10121159 3300009551 Bacteria 2595
34 Ga0105238_11054681 3300009551 Bacteria 835
35 Ga0157371_10005755 3300013102 Bacteria 10386
36 Ga0157380_10345363 3300014326 Bacteria 1390
37 Ga0213876_10002352 3300021384 Bacteria 11130
38 Ga0207680_10025177 3300025903 Bacteria 3280
39 Ga0207695_10039623 3300025913 Bacteria 5062
40 Ga0207695_10254538 3300025913 Bacteria 1655
41 Ga0207681_10036203 3300025923 Bacteria 3255
42 Ga0207694_10093823 3300025924 Bacteria 2371
43 Ga0207690_10010905 3300025932 Bacteria 5417
44 Ga0207679_10138612 3300025945 Bacteria 1963
45 Ga0207668_10088094 3300025972 Bacteria 2272
46 Ga0207668_10146332 3300025972 Bacteria 1823
47 Ga0207668_10151650 3300025972 Bacteria 1795
48 Ga0207658_10039085 3300025986 Bacteria 3422
49 Ga0207639_10040922 3300026041 Bacteria 3463
50 Ga0207639_10206041 3300026041 Bacteria 1690
51 Ga0207676_10081896 3300026095 Bacteria 2623
52 Ga0207675_101197578 3300026118 Bacteria 780
53 Ga0268266_10021190 3300028379 Bacteria 5537
54 Ga0268265_10008948 3300028380 Bacteria 6771
55 Ga0268265_10021592 3300028380 Bacteria 4513
56 Ga0268265_10178285 3300028380 Bacteria 1823
57 Ga0268264_10000045 3300028381 Bacteria 364764
58 Ga0268264_10023572 3300028381 Bacteria 5018
59 Ga0268264_11023522 3300028381 Bacteria 833
60 Ga0307515_10078172 3300028794 Bacteria 4356
61 Ga0307511_10114222 3300030521 Bacteria 1703
62 Ga0265327_10064466 3300031251 Bacteria 1856
63 Ga0307513_10630300 3300031456 Bacteria 780
64 Ga0307413_10111488 3300031824 Bacteria 1832
65 Ga0307413_10298666 3300031824 Bacteria 1220
66 Ga0307406_10001281 3300031901 Bacteria 14085
67 Ga0307414_10040285 3300032004 Bacteria 3154
68 Ga0307414_10045333 3300032004 Bacteria 3010
69 Ga0307414_10073860 3300032004 Bacteria 2468
70 Ga0307414_10161267 3300032004 Bacteria 1781
71 Ga0307414_10201850 3300032004 Bacteria 1618
72 Ga0307414_10216398 3300032004 Bacteria 1570
73 Ga0307414_10217165 3300032004 Bacteria 1567
74 Ga0307414_10352033 3300032004 Bacteria 1264
75 Ga0307414_10464036 3300032004 Bacteria 1113
76 Ga0307414_10479641 3300032004 Bacteria 1096
77 Ga0307510_10237216 3300033180 Bacteria 1321
78 Ga0307510_10255451 3300033180 Bacteria 1237
79 Ga0373933_0416664 3300035724 Bacteria 877
80 Ga0373937_0053609 3300036401 Bacteria 3699
81 Ga0373937_0256089 3300036401 Bacteria 1650
82 Ga0373925_0500306 3300037068 Bacteria 998
83 Ga0395899_0283970 3300037312 Unclassified 1125
84 Ga0395900_0022415 3300037418 Bacteria 6459
85 Ga0395900_0142971 3300037418 Bacteria 2449
86 Ga0395900_0177151 3300037418 Bacteria 2168
87 Ga0395898_0096776 3300037466 Bacteria 2835
88 Ga0395898_0458619 3300037466 Bacteria 1213
89 Ga0395898_0775733 3300037466 Bacteria 899
90 Ga0395905_0019029 3300037471 Bacteria 6513
91 Ga0395905_0022481 3300037471 Bacteria 5963
92 Ga0395905_0036296 3300037471 Bacteria 4629
93 Ga0436364_1127888 3300037853 Bacteria 1037
94 Ga0395901_0036405 3300038443 Bacteria 5087
95 Ga0395901_0329675 3300038443 Bacteria 1578
96 Ga0395901_0480978 3300038443 Bacteria 1266
97 Ga0436365_0577642 3300039437 Bacteria 77516
98 Ga0436360_0708976 3300039438 Bacteria 807
99 Ga0439446_0015985 3300042156 Bacteria 2087
100 Ga0466961_0680307 3300044693 Bacteria 617
101 Ga0453684_0329962 3300044712 Bacteria 1725
102 Ga0495627_002053 3300046453 Bacteria 10280
103 Ga0495638_0017793 3300046460 Bacteria 4731
104 Ga0495650_0111122 3300046471 Bacteria 1017
105 Ga0495610_0012449 3300046512 Bacteria 5120
106 Ga0495631_0235783 3300046518 Bacteria 780
107 Ga0495637_0050192 3300046520 Bacteria 1750
108 Ga0495586_0140129 3300046535 Bacteria 1357
109 Ga0495645_0455965 3300046543 Bacteria 806
110 Ga0495668_0052150 3300046616 Bacteria 2264
111 Ga0495625_0001938 3300046660 Bacteria 23406
112 Ga0495670_0400890 3300046691 Bacteria 741
113 Ga0495649_0000127 3300046694 Bacteria 66636
114 Ga0495687_083117 3300047443 Bacteria 1248
115 Ga0495673_0000182 3300047469 Bacteria 101303
116 Ga0495686_0044597 3300047472 Bacteria 2807
117 Ga0496115_0024757 3300048918 Bacteria 4668
118 Ga0496115_0036918 3300048918 Bacteria 3870
119 Ga0496115_0670303 3300048918 Bacteria 818
120 Ga0496125_0001052 3300048928 Bacteria 42645
121 Ga0496125_0040491 3300048928 Bacteria 3997
122 Ga0496126_0451860 3300048929 Bacteria 1034
123 Ga0501033_0001722 3300049570 Bacteria 19143
124 Ga0501034_0006743 3300049571 Bacteria 12294
125 Ga0501037_0009347 3300049573 Bacteria 7195
126 Ga0501072_0405068 3300049588 Bacteria 1082
127 Ga0501257_014740 3300049686 Bacteria 1802
128 Ga0501035_0104421 3300049822 Bacteria 2485
129 Ga0501044_0000776 3300049823 Bacteria 38704
130 nmdc:mga0k408_64034_c1 3300050493 Bacteria 2139
131 nmdc:mga08y16_470697_c1 3300050511 Bacteria 1279
132 Ga0500643_050000 3300053087 Bacteria 1198
133 Ga0500644_0004411 3300053088 Bacteria 3520
134 Ga0500651_0016240 3300053093 Bacteria 4578
135 Ga0500651_0078211 3300053093 Bacteria 2052
136 Ga0500641_0001789 3300053096 Bacteria 7610
137 Ga0500555_001375 3300053103 Bacteria 7518
138 Ga0500595_006163 3300053119 Bacteria 5131
139 Ga0500573_0218961 3300053140 Bacteria 1000
140 Ga0500577_0000574 3300053142 Bacteria 9486
141 Ga0500622_0048394 3300053156 Bacteria 2193
142 2511121253 2510917020 Bacteria 5657507
143 2512034635 2511231221 Bacteria 6846400
144 2599105282 2597490356 Bacteria 7030811
145 2643751151 2643221545 Bacteria 5083237
146 2643882900 2643221574 Bacteria 2789653
147 2643926703 2643221583 Bacteria 5218014
148 2644088148 2643221614 Bacteria 4260023
149 2644343386 2643221661 Bacteria 4267604
150 2644354589 2643221663 Bacteria 3425771
151 2644369137 2643221666 Bacteria 4265935
152 2644511117 2643221691 Bacteria 5093099
153 2644550174 2643221699 Bacteria 5731501
154 2644552662 2643221699 Bacteria 5731501
155 2846955037 2846952575 Bacteria 6587527
156 2848858671 2848858292 Bacteria 7391279
157 2849562800 2849560528 Bacteria 5393480
158 2849576768 2849573788 Bacteria 5421256
159 2851157462 2851153111 Bacteria 5542585
160 2897803999 2897803580 Bacteria 7000062
161 2941488833 2941485952 Bacteria 3591484
162 8054006504 8054002106 Bacteria 7987183
163 Ga0105248_11497259
164 Ga0070670_100000269
165 Ga0070670_100037907
166 Ga0070666_10079287
167 Ga0070668_100006151
168 Ga0070668_100006159
169 Ga0070669_100026556
170 Ga0070671_100028343
171 Ga0070659_100026952
172 Ga0070667_100402292
173 Ga0068853_100044140
174 Ga0070665_100029258
175 Ga0070664_100013170
176 Ga0068852_100672534
177 Ga0068859_100003944
178 Ga0068864_100093916
179 Ga0068863_100084137
180 Ga0068860_100000032
181 Ga0068860_100005854
182 Ga0068860_100456947
183 Ga0068862_100001662
184 Ga0068862_100009972
185 Ga0068862_100137025
186 Ga0070712_100687960
187 Ga0075366_10068581
188 Ga0097620_100003944
189 Ga0105240_10005291
190 Ga0105240_10026364
191 Ga0111539_10572427
192 Ga0105241_10064498
193 Ga0105248_10027705
194 Ga0105238_10030360
195 Ga0105238_10121159
196 Ga0105238_11054681
197 Ga0157371_10005755
198 Ga0157380_10345363
199 Ga0213876_10002352
200 Ga0207680_10025177
201 Ga0207695_10039623
202 Ga0207695_10254538
203 Ga0207681_10036203
204 Ga0207694_10093823
205 Ga0207690_10010905
206 Ga0207679_10138612
207 Ga0207668_10088094
208 Ga0207668_10146332
209 Ga0207668_10151650
210 Ga0207658_10039085
211 Ga0207639_10040922
212 Ga0207639_10206041
213 Ga0207676_10081896
214 Ga0207675_101197578
215 Ga0268266_10021190
216 Ga0268265_10008948
217 Ga0268265_10021592
218 Ga0268265_10178285
219 Ga0268264_10000045
220 Ga0268264_10023572
221 Ga0268264_11023522
222 Ga0307515_10078172
223 Ga0307511_10114222
224 Ga0265327_10064466
225 Ga0307513_10630300
226 Ga0307413_10111488
227 Ga0307413_10298666
228 Ga0307406_10001281
229 Ga0307414_10040285
230 Ga0307414_10045333
231 Ga0307414_10073860
232 Ga0307414_10161267
233 Ga0307414_10201850
234 Ga0307414_10216398
235 Ga0307414_10217165
236 Ga0307414_10352033
237 Ga0307414_10464036
238 Ga0307414_10479641
239 Ga0307510_10237216
240 Ga0307510_10255451
241 Ga0373933_0416664
242 Ga0373937_0053609
243 Ga0373937_0256089
244 Ga0373925_0500306
245 Ga0395899_0283970
246 Ga0395900_0022415
247 Ga0395900_0142971
248 Ga0395900_0177151
249 Ga0395898_0096776
250 Ga0395898_0458619
251 Ga0395898_0775733
252 Ga0395905_0019029
253 Ga0395905_0022481
254 Ga0395905_0036296
255 Ga0436364_1127888
256 Ga0395901_0036405
257 Ga0395901_0329675
258 Ga0395901_0480978
259 Ga0436365_0577642
260 Ga0436360_0708976
261 Ga0439446_0015985
262 Ga0466961_0680307
263 Ga0453684_0329962
264 Ga0495627_002053
265 Ga0495638_0017793
266 Ga0495650_0111122
267 Ga0495610_0012449
268 Ga0495631_0235783
269 Ga0495637_0050192
270 Ga0495586_0140129
271 Ga0495645_0455965
272 Ga0495668_0052150
273 Ga0495625_0001938
274 Ga0495670_0400890
275 Ga0495649_0000127
276 Ga0495687_083117
277 Ga0495673_0000182
278 Ga0495686_0044597
279 Ga0496115_0024757
280 Ga0496115_0036918
281 Ga0496115_0670303
282 Ga0496125_0001052
283 Ga0496125_0040491
284 Ga0496126_0451860
285 Ga0501033_0001722
286 Ga0501034_0006743
287 Ga0501037_0009347
288 Ga0501072_0405068
289 Ga0501257_014740
290 Ga0501035_0104421
291 Ga0501044_0000776
292 nmdc:mga0k408_64034_c1
293 nmdc:mga08y16_470697_c1
294 Ga0500643_050000
295 Ga0500644_0004411
296 Ga0500651_0016240
297 Ga0500651_0078211
298 Ga0500641_0001789
299 Ga0500555_001375
300 Ga0500595_006163
301 Ga0500573_0218961
302 Ga0500577_0000574
303 Ga0500622_0048394
304 2511121253
305 2512034635
306 2599105282
307 2643751151
308 2643882900
309 2643926703
310 2644088148
311 2644343386
312 2644354589
313 2644369137
314 2644511117
315 2644550174
316 2644552662
317 2846955037
318 2848858671
319 2849562800
320 2849576768
321 2851157462
322 2897803999
323 2941488833
324 8054006504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

21

88

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

16

87

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

19

93

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8791 1 205
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8687 2 205
4jbb-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase a6tby7(target efi-507184) from klebsiella pneumoniae mgh 78578, gsh complex 0.8645 3 205
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8597 2 205
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8578 1 205
ID Description Score Start End Superfamily
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8697 14 80 3.40.30.10
af_I1JFH5_1_87_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8697 2 80 3.40.30.10
3lykA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8653 1 79 3.40.30.10
3cbuB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.863 1 81 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8627 2 78 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2T9JUW3-F1-model_v4 Glutathione S-transferase 0.9953 1 207 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A2T9JUW3-F1-model_v4 Glutathione S-transferase 0.9905 1 207 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A528AY30-F1-model_v4 Glutathione S-transferase 0.9735 54 175 GO:0016740
AF-A0A6N0DX65-F1-model_v4 Glutathione S-transferase family protein 0.9711 2 206 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A7Y2BLA2-F1-model_v4 Glutathione S-transferase 0.9686 2 206 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Map