F235655

General Info

Members Datasets Scaffolds Average Seq Length
160 67 320 190

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0153064|Ga0501045_0153064_252_824
Length 175
Sequence MPRDYKNISPTAFQRLPEYKRRDAWICSFLRQASVGHIASARDGQPFLNPTTFWFDEDNHQIIFHSNVTGRIRSNILLPSNIALEFSLQYRSVIVFGRAHLIEDAEAARRALYGLIHKYFPSLTAGKEFREITDRELKRTSVYAIQIEEWSGKENWKDRADQSDEWPALDEKWFS

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
41 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
42 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
43 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
44 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
45 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
46 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
49 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
50 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
53 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
54 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
57 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
58 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
59 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
60 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
61 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
62 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
63 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
64 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
65 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
66 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
67 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 26.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0153064 3300049824 Unclassified 1716
2 SwRhRL3b_contig_1459761 2162886006 Bacteria 1617
3 SwRhRL3b_contig_3529489 2162886006 Bacteria 3121
4 SwRhRL2b_contig_1471271 2162886007 Bacteria 3821
5 JGI25406J46586_10012019 3300003203 Bacteria 3773
6 Ga0065704_10070873 3300005289 Bacteria 15162
7 Ga0065707_10082490 3300005295 Bacteria 14583
8 Ga0065707_10085545 3300005295 Bacteria 6076
9 Ga0065707_10184370 3300005295 Bacteria 1398
10 Ga0065707_10189363 3300005295 Unclassified 1370
11 Ga0065707_10525184 3300005295 Unclassified 739
12 Ga0070694_100247309 3300005444 Bacteria 1348
13 Ga0070694_100634927 3300005444 Unclassified 863
14 Ga0070662_100447841 3300005457 Unclassified 1071
15 Ga0070706_100054375 3300005467 Unclassified 3695
16 Ga0070706_100143681 3300005467 Bacteria 2228
17 Ga0070706_100345044 3300005467 Bacteria 1388
18 Ga0070707_100122335 3300005468 Unclassified 2526
19 Ga0070707_100142956 3300005468 Bacteria 2328
20 Ga0070698_100035404 3300005471 Bacteria 5163
21 Ga0070698_100043117 3300005471 Unclassified 4627
22 Ga0070698_100052350 3300005471 Bacteria 4153
23 Ga0070698_100191663 3300005471 Bacteria 1982
24 Ga0070699_100001712 3300005518 Bacteria 20004
25 Ga0070699_100077322 3300005518 Bacteria 2897
26 Ga0070697_100070943 3300005536 Bacteria 2857
27 Ga0070696_100406198 3300005546 Unclassified 1067
28 Ga0070704_100723707 3300005549 Unclassified 884
29 Ga0068857_100827738 3300005577 Bacteria 885
30 Ga0068857_101170705 3300005577 Unclassified 744
31 Ga0068859_100819934 3300005617 Bacteria 1017
32 Ga0068863_100418795 3300005841 Bacteria 1312
33 Ga0068860_100775977 3300005843 Unclassified 971
34 Ga0068862_100242900 3300005844 Bacteria 1638
35 Ga0068862_100342122 3300005844 Bacteria 1386
36 Ga0068862_100351959 3300005844 Unclassified 1367
37 Ga0075428_100065575 3300006844 Bacteria 3976
38 Ga0075428_100585216 3300006844 Bacteria 1192
39 Ga0075428_100870561 3300006844 Unclassified 956
40 Ga0075430_100177507 3300006846 Bacteria 1772
41 Ga0075430_100185004 3300006846 Bacteria 1732
42 Ga0075431_100355636 3300006847 Bacteria 1472
43 Ga0075433_10151287 3300006852 Bacteria 2064
44 Ga0075433_10340500 3300006852 Bacteria 1326
45 Ga0075429_100005201 3300006880 Bacteria 11190
46 Ga0075429_100031934 3300006880 Bacteria 4578
47 Ga0075429_100095156 3300006880 Bacteria 2598
48 Ga0075429_100107128 3300006880 Bacteria 2442
49 Ga0075429_100185737 3300006880 Bacteria 1821
50 Ga0097620_100820011 3300006931 Bacteria 1017
51 Ga0111539_10324687 3300009094 Bacteria 1791
52 Ga0114129_10000859 3300009147 Bacteria 39455
53 Ga0114129_10030186 3300009147 Bacteria 7678
54 Ga0114129_10033437 3300009147 Bacteria 7267
55 Ga0114129_10046685 3300009147 Bacteria 6086
56 Ga0114129_10230028 3300009147 Bacteria 2497
57 Ga0114129_10424978 3300009147 Bacteria 1747
58 Ga0114129_11230367 3300009147 Unclassified 931
59 Ga0114129_11369788 3300009147 Bacteria 874
60 Ga0105243_10018910 3300009148 Bacteria 5224
61 Ga0105243_10770885 3300009148 Bacteria 945
62 Ga0105249_10008663 3300009553 Bacteria 8860
63 Ga0105249_10509836 3300009553 Unclassified 1249
64 Ga0105246_10041680 3300011119 Bacteria 3104
65 Ga0105246_10045825 3300011119 Bacteria 2980
66 Ga0207684_10228726 3300025910 Unclassified 1605
67 Ga0207684_10306098 3300025910 Bacteria 1370
68 Ga0207684_10331664 3300025910 Bacteria 1311
69 Ga0207646_10120216 3300025922 Bacteria 2360
70 Ga0207709_10049615 3300025935 Bacteria 2563
71 Ga0207709_10073874 3300025935 Unclassified 2174
72 Ga0207712_10167954 3300025961 Unclassified 1712
73 Ga0207712_10327566 3300025961 Bacteria 1266
74 Ga0207674_10346989 3300026116 Unclassified 1435
75 Ga0207675_100250130 3300026118 Bacteria 1715
76 Ga0268265_10069203 3300028380 Bacteria 2740
77 Ga0268265_10220810 3300028380 Bacteria 1658
78 Ga0268265_10242973 3300028380 Bacteria 1590
79 Ga0265338_10100643 3300028800 Bacteria 2356
80 Ga0265320_10007141 3300031240 Bacteria 6963
81 Ga0265325_10197802 3300031241 Unclassified 929
82 Ga0265340_10049848 3300031247 Bacteria 2032
83 Ga0265316_10164807 3300031344 Unclassified 1656
84 Ga0316576_10105365 3300031727 Bacteria 2111
85 Ga0316578_10056516 3300031728 Unclassified 2305
86 Ga0307410_10209024 3300031852 Unclassified 1494
87 Ga0307409_100666782 3300031995 Unclassified 1036
88 Ga0307414_10579526 3300032004 Unclassified 1004
89 Ga0316581_0008727 3300037588 Unclassified 2769
90 Ga0451577_0004261 3300042876 Bacteria 15215
91 Ga0451577_0043527 3300042876 Unclassified 4022
92 Ga0451577_0225266 3300042876 Bacteria 1695
93 Ga0451577_0313153 3300042876 Unclassified 1423
94 Ga0451577_0329912 3300042876 Unclassified 1384
95 Ga0451577_0662884 3300042876 Bacteria 946
96 Ga0453683_0000599 3300044673 Bacteria 39641
97 Ga0453683_0010279 3300044673 Bacteria 6205
98 Ga0453683_0017320 3300044673 Bacteria 4641
99 Ga0453683_0049091 3300044673 Bacteria 2646
100 Ga0453683_0111641 3300044673 Bacteria 1719
101 Ga0453684_0000106 3300044712 Bacteria 364365
102 Ga0453684_0000548 3300044712 Bacteria 142109
103 Ga0453684_0006588 3300044712 Bacteria 21965
104 Ga0453684_0017697 3300044712 Bacteria 11011
105 Ga0453684_0018076 3300044712 Bacteria 10852
106 Ga0453684_0051003 3300044712 Bacteria 5432
107 Ga0453684_0052502 3300044712 Bacteria 5329
108 Ga0453684_0058584 3300044712 Bacteria 4973
109 Ga0453684_0065992 3300044712 Bacteria 4611
110 Ga0453684_0073789 3300044712 Bacteria 4299
111 Ga0453684_0104599 3300044712 Bacteria 3455
112 Ga0453684_0132795 3300044712 Bacteria 2985
113 Ga0453684_0151699 3300044712 Bacteria 2753
114 Ga0453684_0181912 3300044712 Unclassified 2467
115 Ga0453684_0227687 3300044712 Bacteria 2154
116 Ga0453684_0254916 3300044712 Bacteria 2013
117 Ga0453684_0259707 3300044712 Bacteria 1990
118 Ga0453684_0323754 3300044712 Bacteria 1745
119 Ga0453684_0332207 3300044712 Bacteria 1719
120 Ga0453684_0343141 3300044712 Unclassified 1686
121 Ga0453684_0383333 3300044712 Unclassified 1578
122 Ga0453684_0593270 3300044712 Unclassified 1215
123 Ga0451576_0004215 3300045051 Bacteria 18895
124 Ga0451576_0032949 3300045051 Bacteria 5509
125 Ga0451576_0106629 3300045051 Bacteria 2915
126 Ga0451576_0119627 3300045051 Bacteria 2742
127 Ga0451576_0158837 3300045051 Bacteria 2359
128 Ga0451576_0329283 3300045051 Bacteria 1599
129 Ga0451576_0388037 3300045051 Unclassified 1464
130 Ga0451576_0818923 3300045051 Bacteria 977
131 Ga0501041_0155070 3300049577 Unclassified 1431
132 Ga0501048_0421690 3300049582 Unclassified 955
133 Ga0501071_0722513 3300049587 Unclassified 767
134 Ga0501076_0248105 3300049592 Bacteria 1456
135 Ga0501076_1016795 3300049592 Bacteria 683
136 Ga0501079_0059887 3300049741 Bacteria 2937
137 Ga0501081_0060607 3300049743 Bacteria 2622
138 nmdc:mga05p37_133755_c1 3300050507 Bacteria 3042
139 nmdc:mga05p37_1440_c1 3300050507 Bacteria 27647
140 nmdc:mga05p37_15457_c1 3300050507 Bacteria 5048
141 nmdc:mga05p37_192453_c1 3300050507 Bacteria 2475
142 nmdc:mga05p37_210258_c1 3300050507 Bacteria 2352
143 nmdc:mga05p37_705810_c1 3300050507 Bacteria 1120
144 nmdc:mga09592_15877_c1 3300050508 Bacteria 6154
145 nmdc:mga09592_159908_c1 3300050508 Bacteria 1946
146 nmdc:mga09592_2466_c1 3300050508 Bacteria 14930
147 nmdc:mga09592_257144_c1 3300050508 Bacteria 1514
148 nmdc:mga09592_29419_c1 3300050508 Bacteria 2405
149 nmdc:mga09592_80199_c1 3300050508 Bacteria 2779
150 nmdc:mga0qj67_142098_c1 3300050509 Bacteria 1946
151 nmdc:mga0qj67_169231_c1 3300050509 Bacteria 1774
152 nmdc:mga0qj67_489829_c1 3300050509 Unclassified 989
153 nmdc:mga06r32_281957_c2 3300050510 Unclassified 886
154 nmdc:mga0a205_101221_c1 3300050515 Bacteria 2780
155 Ga0501084_0469837 3300054114 Unclassified 1063
156 Ga0501084_0831827 3300054114 Bacteria 777
157 Ga0501082_0182545 3300060353 Bacteria 1825
158 Ga0501082_0283470 3300060353 Bacteria 1442
159 Ga0530510_0119988 3300061734 Bacteria 1930
160 Ga0530510_0577179 3300061734 Unclassified 855
161 Ga0501045_0153064
162 SwRhRL3b_contig_1459761
163 SwRhRL3b_contig_3529489
164 SwRhRL2b_contig_1471271
165 JGI25406J46586_10012019
166 Ga0065704_10070873
167 Ga0065707_10082490
168 Ga0065707_10085545
169 Ga0065707_10184370
170 Ga0065707_10189363
171 Ga0065707_10525184
172 Ga0070694_100247309
173 Ga0070694_100634927
174 Ga0070662_100447841
175 Ga0070706_100054375
176 Ga0070706_100143681
177 Ga0070706_100345044
178 Ga0070707_100122335
179 Ga0070707_100142956
180 Ga0070698_100035404
181 Ga0070698_100043117
182 Ga0070698_100052350
183 Ga0070698_100191663
184 Ga0070699_100001712
185 Ga0070699_100077322
186 Ga0070697_100070943
187 Ga0070696_100406198
188 Ga0070704_100723707
189 Ga0068857_100827738
190 Ga0068857_101170705
191 Ga0068859_100819934
192 Ga0068863_100418795
193 Ga0068860_100775977
194 Ga0068862_100242900
195 Ga0068862_100342122
196 Ga0068862_100351959
197 Ga0075428_100065575
198 Ga0075428_100585216
199 Ga0075428_100870561
200 Ga0075430_100177507
201 Ga0075430_100185004
202 Ga0075431_100355636
203 Ga0075433_10151287
204 Ga0075433_10340500
205 Ga0075429_100005201
206 Ga0075429_100031934
207 Ga0075429_100095156
208 Ga0075429_100107128
209 Ga0075429_100185737
210 Ga0097620_100820011
211 Ga0111539_10324687
212 Ga0114129_10000859
213 Ga0114129_10030186
214 Ga0114129_10033437
215 Ga0114129_10046685
216 Ga0114129_10230028
217 Ga0114129_10424978
218 Ga0114129_11230367
219 Ga0114129_11369788
220 Ga0105243_10018910
221 Ga0105243_10770885
222 Ga0105249_10008663
223 Ga0105249_10509836
224 Ga0105246_10041680
225 Ga0105246_10045825
226 Ga0207684_10228726
227 Ga0207684_10306098
228 Ga0207684_10331664
229 Ga0207646_10120216
230 Ga0207709_10049615
231 Ga0207709_10073874
232 Ga0207712_10167954
233 Ga0207712_10327566
234 Ga0207674_10346989
235 Ga0207675_100250130
236 Ga0268265_10069203
237 Ga0268265_10220810
238 Ga0268265_10242973
239 Ga0265338_10100643
240 Ga0265320_10007141
241 Ga0265325_10197802
242 Ga0265340_10049848
243 Ga0265316_10164807
244 Ga0316576_10105365
245 Ga0316578_10056516
246 Ga0307410_10209024
247 Ga0307409_100666782
248 Ga0307414_10579526
249 Ga0316581_0008727
250 Ga0451577_0004261
251 Ga0451577_0043527
252 Ga0451577_0225266
253 Ga0451577_0313153
254 Ga0451577_0329912
255 Ga0451577_0662884
256 Ga0453683_0000599
257 Ga0453683_0010279
258 Ga0453683_0017320
259 Ga0453683_0049091
260 Ga0453683_0111641
261 Ga0453684_0000106
262 Ga0453684_0000548
263 Ga0453684_0006588
264 Ga0453684_0017697
265 Ga0453684_0018076
266 Ga0453684_0051003
267 Ga0453684_0052502
268 Ga0453684_0058584
269 Ga0453684_0065992
270 Ga0453684_0073789
271 Ga0453684_0104599
272 Ga0453684_0132795
273 Ga0453684_0151699
274 Ga0453684_0181912
275 Ga0453684_0227687
276 Ga0453684_0254916
277 Ga0453684_0259707
278 Ga0453684_0323754
279 Ga0453684_0332207
280 Ga0453684_0343141
281 Ga0453684_0383333
282 Ga0453684_0593270
283 Ga0451576_0004215
284 Ga0451576_0032949
285 Ga0451576_0106629
286 Ga0451576_0119627
287 Ga0451576_0158837
288 Ga0451576_0329283
289 Ga0451576_0388037
290 Ga0451576_0818923
291 Ga0501041_0155070
292 Ga0501048_0421690
293 Ga0501071_0722513
294 Ga0501076_0248105
295 Ga0501076_1016795
296 Ga0501079_0059887
297 Ga0501081_0060607
298 nmdc:mga05p37_133755_c1
299 nmdc:mga05p37_1440_c1
300 nmdc:mga05p37_15457_c1
301 nmdc:mga05p37_192453_c1
302 nmdc:mga05p37_210258_c1
303 nmdc:mga05p37_705810_c1
304 nmdc:mga09592_15877_c1
305 nmdc:mga09592_159908_c1
306 nmdc:mga09592_2466_c1
307 nmdc:mga09592_257144_c1
308 nmdc:mga09592_29419_c1
309 nmdc:mga09592_80199_c1
310 nmdc:mga0qj67_142098_c1
311 nmdc:mga0qj67_169231_c1
312 nmdc:mga0qj67_489829_c1
313 nmdc:mga06r32_281957_c2
314 nmdc:mga0a205_101221_c1
315 Ga0501084_0469837
316 Ga0501084_0831827
317 Ga0501082_0182545
318 Ga0501082_0283470
319 Ga0530510_0119988
320 Ga0530510_0577179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

23

106

0.95

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

22

154

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hti-assembly1.cif.gz_A-2 crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution 0.863 21 173
2hti-assembly1.cif.gz_A-2 crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution 0.8438 21 173
5jab-assembly2.cif.gz_D structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.838 22 169
6vna-assembly1.cif.gz_C pden_1323 0.8306 24 120
2fg9-assembly1.cif.gz_A crystal structure of a putative 5-nitroimidazole antibiotic resistance protein (bt_3078) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution 0.8253 21 169
ID Description Score Start End Superfamily
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8593 21 171 2.30.110.10
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8477 21 173 2.30.110.10
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8283 21 173 2.30.110.10
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8157 23 180 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8105 20 168 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A511FCN7-F1-model_v4 PPOX class F420-dependent enzyme (PPOX class probable F420-dependent enzyme) 0.8887 28 169 GO:0005829
GO:0016627
GO:0070967
AF-A0A2S8N077-F1-model_v4 deleted 0.8877 26 89
AF-A0A533V030-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.8864 21 118 GO:0005829
GO:0016627
GO:0070967
AF-A0A533V030-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.8767 21 118 GO:0005829
GO:0016627
GO:0070967
AF-A0A521WG82-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.8714 18 173

Map