F230724

General Info

Members Datasets Scaffolds Average Seq Length
158 141 150 194

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0183366|Ga0501079_0183366_683_1183
Length 166
Sequence VNPQVDAFLRDAPAWRDELTALRAIVLDSGLAEDWKWRAPCYTFEGRNVAILGAFRAYCALGFFKGALLKDADGILTAPGKDSQFMRQARFTDVRRIAELEAVLRADIAEAVEVRPDLRAAFDALTPGRRRGYVLHIAGGKRSATRRSRVERCAPRILDGKGLHDR

Samples

Sample ID Description Type Environment
1 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
2 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
3 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
4 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
5 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
6 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
7 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
8 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.3
Metatranscriptomes 0.63
Isolates 5.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.76
Nodule 0
Rhizoplane 1.9
Rhizosphere 80.38
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10031417 3300003187 Bacteria 2075
2 Ga0055526_1000236 3300003771 Bacteria 46607
3 Ga0055537_1000074 3300003773 Bacteria 71264
4 Ga0055524_1005982 3300003775 Bacteria 5349
5 Ga0055534_1000033 3300003784 Bacteria 116700
6 Ga0055528_1000020 3300003790 Bacteria 144617
7 Ga0065704_10080721 3300005289 Bacteria 3891
8 Ga0070676_10140907 3300005328 Bacteria 1535
9 Ga0070683_100068705 3300005329 Bacteria 3302
10 Ga0070683_100076042 3300005329 Bacteria 3138
11 Ga0070670_100136911 3300005331 Bacteria 2116
12 Ga0070670_100378520 3300005331 Bacteria 1247
13 Ga0070682_100020134 3300005337 Bacteria 3923
14 Ga0068868_100182676 3300005338 Bacteria 1741
15 Ga0070660_100125933 3300005339 Bacteria 2047
16 Ga0070661_100122811 3300005344 Bacteria 1946
17 Ga0070675_100437233 3300005354 Unclassified 1172
18 Ga0070671_100100020 3300005355 Bacteria 2433
19 Ga0070659_100013306 3300005366 Bacteria 6120
20 Ga0070709_10185469 3300005434 Bacteria 1464
21 Ga0070713_100079764 3300005436 Bacteria 2789
22 Ga0070711_100065452 3300005439 Bacteria 2542
23 Ga0070700_100151288 3300005441 Bacteria 1587
24 Ga0070663_100154804 3300005455 Bacteria 1760
25 Ga0070685_10367854 3300005466 Bacteria 987
26 Ga0070707_100038109 3300005468 Bacteria 4590
27 Ga0070684_100010044 3300005535 Bacteria 7483
28 Ga0070684_100026902 3300005535 Bacteria 4849
29 Ga0070697_100062006 3300005536 Bacteria 3050
30 Ga0070672_100624256 3300005543 Bacteria 940
31 Ga0070695_100290594 3300005545 Bacteria 1205
32 Ga0070695_100551140 3300005545 Bacteria 899
33 Ga0070665_100088700 3300005548 Bacteria 3098
34 Ga0070664_100033585 3300005564 Bacteria 4298
35 Ga0068852_100327939 3300005616 Unclassified 1488
36 Ga0068861_100330663 3300005719 Bacteria 1330
37 Ga0068863_100206084 3300005841 Bacteria 1892
38 Ga0068858_100201538 3300005842 Bacteria 1882
39 Ga0068858_100410814 3300005842 Bacteria 1301
40 Ga0081455_10002166 3300005937 Bacteria 23432
41 Ga0081455_10004799 3300005937 Bacteria 15022
42 Ga0070717_10104035 3300006028 Bacteria 2414
43 Ga0075365_10027229 3300006038 Bacteria 3635
44 Ga0070715_10041034 3300006163 Bacteria 1938
45 Ga0070712_100305124 3300006175 Bacteria 1289
46 Ga0075436_100001380 3300006914 Bacteria 16523
47 Ga0114129_10142552 3300009147 Bacteria 3283
48 Ga0105237_10005904 3300009545 Bacteria 13729
49 Ga0105238_10712004 3300009551 Bacteria 1016
50 Ga0105239_10004595 3300010375 Bacteria 16444
51 Ga0157378_10063297 3300013297 Bacteria 3305
52 Ga0157378_11815844 3300013297 Bacteria 658
53 Ga0163162_10441455 3300013306 Bacteria 1434
54 Ga0157372_10025807 3300013307 Bacteria 6391
55 Ga0157372_10223361 3300013307 Bacteria 2183
56 Ga0163163_10055111 3300014325 Bacteria 3929
57 Ga0163163_10237396 3300014325 Bacteria 1872
58 Ga0157380_11519350 3300014326 Bacteria 723
59 Ga0157376_10222445 3300014969 Bacteria 1749
60 Ga0182006_1000011 3300015261 Bacteria 408647
61 Ga0213873_10077466 3300021358 Bacteria 926
62 Ga0213872_10001654 3300021361 Bacteria 14039
63 Ga0209565_1000032 3300025263 Bacteria 316777
64 Ga0209673_1000029 3300025273 Bacteria 351978
65 Ga0209675_1000019 3300025291 Bacteria 351950
66 Ga0209025_1002097 3300025294 Bacteria 22544
67 Ga0209564_1000115 3300025295 Bacteria 208988
68 Ga0209256_1000058 3300025299 Bacteria 272934
69 Ga0207697_10002925 3300025315 Bacteria 8643
70 Ga0207697_10095291 3300025315 Bacteria 1264
71 Ga0207645_10085638 3300025907 Bacteria 2024
72 Ga0207671_10023472 3300025914 Bacteria 4652
73 Ga0207693_10031958 3300025915 Bacteria 4158
74 Ga0207657_10192872 3300025919 Bacteria 1642
75 Ga0207649_10020232 3300025920 Bacteria 3814
76 Ga0207649_10194896 3300025920 Bacteria 1427
77 Ga0207646_10263837 3300025922 Bacteria 1556
78 Ga0207650_10071801 3300025925 Bacteria 2605
79 Ga0207659_10052137 3300025926 Bacteria 2913
80 Ga0207700_10045140 3300025928 Bacteria 3249
81 Ga0207644_10321939 3300025931 Bacteria 1250
82 Ga0207690_10235235 3300025932 Bacteria 1408
83 Ga0207706_10059019 3300025933 Bacteria 3379
84 Ga0207670_10095431 3300025936 Bacteria 2112
85 Ga0207661_10029315 3300025944 Bacteria 4226
86 Ga0207661_10512724 3300025944 Bacteria 1096
87 Ga0207679_10011725 3300025945 Bacteria 5691
88 Ga0207679_11104674 3300025945 Bacteria 727
89 Ga0207668_10249405 3300025972 Bacteria 1441
90 Ga0207703_10356302 3300026035 Bacteria 1348
91 Ga0207639_10200497 3300026041 Unclassified 1711
92 Ga0207678_10007512 3300026067 Bacteria 9636
93 Ga0207641_10021166 3300026088 Bacteria 5346
94 Ga0268266_10322617 3300028379 Bacteria 1446
95 Ga0268264_10606159 3300028381 Bacteria 1079
96 Ga0265326_10001037 3300028558 Bacteria 9939
97 Ga0307515_10000074 3300028794 Bacteria 229874
98 Ga0307515_10001368 3300028794 Bacteria 55146
99 Ga0265338_10021233 3300028800 Bacteria 6781
100 Ga0265340_10160126 3300031247 Bacteria 1023
101 Ga0307509_10138998 3300031507 Bacteria 2369
102 Ga0307508_10093594 3300031616 Bacteria 2595
103 Ga0265314_10017230 3300031711 Bacteria 5675
104 Ga0307414_10178276 3300032004 Bacteria 1706
105 Ga0307411_10625525 3300032005 Bacteria 929
106 Ga0316583_10088119 3300032133 Bacteria 1083
107 Ga0316593_10030703 3300032168 Bacteria 1746
108 Ga0395900_0626452 3300037418 Bacteria 1014
109 Ga0395905_1214899 3300037471 Bacteria 657
110 Ga0436360_0913318 3300039438 Bacteria 690
111 Ga0436361_0350692 3300039447 Bacteria 15345
112 Ga0436361_0741551 3300039447 Bacteria 1672
113 Ga0436363_1639024 3300039450 Bacteria 4122
114 Ga0436362_0012587 3300039453 Bacteria 4292
115 Ga0451577_0125364 3300042876 Bacteria 2301
116 Ga0466969_0001229 3300044656 Bacteria 13855
117 Ga0466972_0254065 3300044658 Bacteria 822
118 Ga0466966_0034190 3300044684 Bacteria 3288
119 Ga0453684_0000800 3300044712 Bacteria 107265
120 Ga0466970_0307639 3300044765 Bacteria 895
121 Ga0466959_0000014 3300045049 Bacteria 150962
122 Ga0495627_000003 3300046453 Bacteria 704557
123 Ga0495627_006597 3300046453 Bacteria 4534
124 Ga0495638_0195349 3300046460 Bacteria 1146
125 Ga0495652_0182512 3300046529 Bacteria 1609
126 Ga0495654_0000001 3300046530 Bacteria 1513197
127 Ga0495633_0000869 3300046558 Bacteria 26201
128 Ga0495611_0000086 3300046648 Bacteria 66762
129 Ga0495625_0081739 3300046660 Bacteria 2248
130 Ga0495649_0064330 3300046694 Bacteria 1970
131 Ga0495660_0104542 3300046810 Bacteria 1453
132 Ga0495672_0252062 3300047320 Bacteria 856
133 Ga0495686_0001041 3300047472 Bacteria 33277
134 Ga0495686_0050814 3300047472 Bacteria 2604
135 Ga0496108_0315590 3300048911 Bacteria 1362
136 Ga0496110_0109695 3300048913 Bacteria 2479
137 Ga0496113_0290320 3300048916 Bacteria 1308
138 Ga0496121_0235453 3300048924 Bacteria 1280
139 Ga0496122_0000109 3300048925 Bacteria 190828
140 Ga0501299_182322 3300049522 Bacteria 549
141 Ga0501034_0008497 3300049571 Bacteria 10843
142 Ga0501079_0183366 3300049741 Bacteria 1634
143 nmdc:mga0yw44_46299_c1 3300050492 Bacteria 2611
144 nmdc:mga05p37_89597_c1 3300050507 Bacteria 3791
145 nmdc:mga08x19_20_c1 3300050514 Bacteria 304974
146 Ga0495619_0495249 3300053085 Bacteria 841
147 Ga0500651_0048292 3300053093 Bacteria 2674
148 Ga0500616_0037412 3300053153 Bacteria 2628
149 Ga0500661_031083 3300055283 Bacteria 942
150 Ga0466962_0339204 3300061719 Bacteria 747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049522 Ga0501299_182322 Ga0501299_182322_38_526 162
2 3300049741 Ga0501079_0183366 Ga0501079_0183366_683_1183 165
3 3300005545 Ga0070695_100290594 Ga0070695_1002905941 172
4 3300032168 Ga0316593_10030703 Ga0316593_100307032 179
5 3300009551 Ga0105238_10712004 Ga0105238_107120042 185
6 iso_pu_bacteria 2585428061 2587750764 188
7 iso_pu_bacteria 2751185877 2753672502 188
8 iso_pu_bacteria 2929239360 2929244598 188
9 iso_pu_bacteria 2945924605 2945927188 188
10 3300014969 Ga0157376_10222445 Ga0157376_102224452 190
11 3300005289 Ga0065704_10080721 Ga0065704_100807213 192
12 3300005337 Ga0070682_100020134 Ga0070682_1000201344 192
13 3300005466 Ga0070685_10367854 Ga0070685_103678541 192
14 3300005468 Ga0070707_100038109 Ga0070707_1000381093 192
15 3300006163 Ga0070715_10041034 Ga0070715_100410343 192
16 3300013297 Ga0157378_11815844 Ga0157378_118158441 192
17 3300013307 Ga0157372_10025807 Ga0157372_100258074 192
18 3300014325 Ga0163163_10055111 Ga0163163_100551116 192
19 3300014326 Ga0157380_11519350 Ga0157380_115193501 192
20 3300015261 Ga0182006_1000011 Ga0182006_1000011394 192
21 3300021361 Ga0213872_10001654 Ga0213872_100016547 192
22 3300025922 Ga0207646_10263837 Ga0207646_102638373 192
23 3300025928 Ga0207700_10045140 Ga0207700_100451403 192
24 3300025931 Ga0207644_10321939 Ga0207644_103219392 192
25 3300025972 Ga0207668_10249405 Ga0207668_102494052 192
26 3300026088 Ga0207641_10021166 Ga0207641_100211668 192
27 3300028379 Ga0268266_10322617 Ga0268266_103226173 192
28 3300028794 Ga0307515_10001368 Ga0307515_1000136854 192
29 3300031507 Ga0307509_10138998 Ga0307509_101389983 192
30 3300031616 Ga0307508_10093594 Ga0307508_100935945 192
31 3300032005 Ga0307411_10625525 Ga0307411_106255252 192
32 3300037471 Ga0395905_1214899 Ga0395905_1214899_59_637 192
33 3300039438 Ga0436360_0913318 Ga0436360_0913318_12_593 192
34 3300039447 Ga0436361_0350692 Ga0436361_0350692_950_1531 192
35 3300039447 Ga0436361_0741551 Ga0436361_0741551_177_755 192
36 3300042876 Ga0451577_0125364 Ga0451577_0125364_1073_1651 192
37 3300044656 Ga0466969_0001229 Ga0466969_0001229_9902_10480 192
38 3300044658 Ga0466972_0254065 Ga0466972_0254065_122_700 192
39 3300044684 Ga0466966_0034190 Ga0466966_0034190_1940_2518 192
40 3300044712 Ga0453684_0000800 Ga0453684_0000800_82883_83461 192
41 3300044765 Ga0466970_0307639 Ga0466970_0307639_285_863 192
42 3300045049 Ga0466959_0000014 Ga0466959_0000014_143277_143855 192
43 3300046453 Ga0495627_000003 Ga0495627_000003_311602_312180 192
44 3300046453 Ga0495627_006597 Ga0495627_006597_1912_2490 192
45 3300046460 Ga0495638_0195349 Ga0495638_0195349_272_850 192
46 3300046529 Ga0495652_0182512 Ga0495652_0182512_262_840 192
47 3300046530 Ga0495654_0000001 Ga0495654_0000001_808311_808889 192
48 3300046558 Ga0495633_0000869 Ga0495633_0000869_9085_9663 192
49 3300046648 Ga0495611_0000086 Ga0495611_0000086_43317_43898 192
50 3300046660 Ga0495625_0081739 Ga0495625_0081739_1563_2141 192
51 3300046694 Ga0495649_0064330 Ga0495649_0064330_727_1329 192
52 3300046810 Ga0495660_0104542 Ga0495660_0104542_479_1057 192
53 3300047320 Ga0495672_0252062 Ga0495672_0252062_167_745 192
54 3300047472 Ga0495686_0001041 Ga0495686_0001041_30762_31340 192
55 3300047472 Ga0495686_0050814 Ga0495686_0050814_667_1245 192
56 3300048925 Ga0496122_0000109 Ga0496122_0000109_84025_84603 192
57 3300050514 nmdc:mga08x19_20_c1 nmdc:mga08x19_20_c1_179551_180132 192
58 3300053085 Ga0495619_0495249 Ga0495619_0495249_173_751 192
59 3300053093 Ga0500651_0048292 Ga0500651_0048292_238_816 192
60 3300053153 Ga0500616_0037412 Ga0500616_0037412_1981_2562 192
61 3300061719 Ga0466962_0339204 Ga0466962_0339204_45_623 192
62 iso_pu_bacteria 3001892409 3001896796 193
63 iso_pu_bacteria 3006826541 3006828955 193
64 iso_pu_bacteria 3006858327 3006860538 193
65 3300003771 Ga0055526_1000236 Ga0055526_100023626 194
66 3300003773 Ga0055537_1000074 Ga0055537_100007415 194
67 3300003775 Ga0055524_1005982 Ga0055524_10059823 194
68 3300003784 Ga0055534_1000033 Ga0055534_100003371 194
69 3300003790 Ga0055528_1000020 Ga0055528_100002071 194
70 3300025263 Ga0209565_1000032 Ga0209565_1000032245 194
71 3300025273 Ga0209673_1000029 Ga0209673_1000029270 194
72 3300025291 Ga0209675_1000019 Ga0209675_100001973 194
73 3300025295 Ga0209564_1000115 Ga0209564_1000115135 194
74 3300025299 Ga0209256_1000058 Ga0209256_1000058218 194
75 iso_pu_bacteria 2751185905 2753810800 194
76 3300005328 Ga0070676_10140907 Ga0070676_101409072 195
77 3300005329 Ga0070683_100076042 Ga0070683_1000760424 195
78 3300005331 Ga0070670_100378520 Ga0070670_1003785202 195
79 3300005355 Ga0070671_100100020 Ga0070671_1001000204 195
80 3300005434 Ga0070709_10185469 Ga0070709_101854693 195
81 3300005436 Ga0070713_100079764 Ga0070713_1000797644 195
82 3300005439 Ga0070711_100065452 Ga0070711_1000654523 195
83 3300005455 Ga0070663_100154804 Ga0070663_1001548043 195
84 3300005535 Ga0070684_100026902 Ga0070684_1000269026 195
85 3300005545 Ga0070695_100551140 Ga0070695_1005511401 195
86 3300005548 Ga0070665_100088700 Ga0070665_1000887006 195
87 3300005564 Ga0070664_100033585 Ga0070664_1000335855 195
88 3300005842 Ga0068858_100410814 Ga0068858_1004108142 195
89 3300005937 Ga0081455_10002166 Ga0081455_1000216622 195
90 3300005937 Ga0081455_10004799 Ga0081455_100047998 195
91 3300006028 Ga0070717_10104035 Ga0070717_101040353 195
92 3300006175 Ga0070712_100305124 Ga0070712_1003051242 195
93 3300006914 Ga0075436_100001380 Ga0075436_10000138012 195
94 3300009147 Ga0114129_10142552 Ga0114129_101425526 195
95 3300009545 Ga0105237_10005904 Ga0105237_100059048 195
96 3300010375 Ga0105239_10004595 Ga0105239_100045958 195
97 3300013297 Ga0157378_10063297 Ga0157378_100632975 195
98 3300013307 Ga0157372_10223361 Ga0157372_102233613 195
99 3300014325 Ga0163163_10237396 Ga0163163_102373964 195
100 3300025315 Ga0207697_10095291 Ga0207697_100952912 195
101 3300025907 Ga0207645_10085638 Ga0207645_100856384 195
102 3300025914 Ga0207671_10023472 Ga0207671_100234722 195
103 3300025915 Ga0207693_10031958 Ga0207693_100319582 195
104 3300025920 Ga0207649_10194896 Ga0207649_101948963 195
105 3300025933 Ga0207706_10059019 Ga0207706_100590193 195
106 3300025944 Ga0207661_10512724 Ga0207661_105127242 195
107 3300025945 Ga0207679_11104674 Ga0207679_111046741 195
108 3300026035 Ga0207703_10356302 Ga0207703_103563022 195
109 3300026067 Ga0207678_10007512 Ga0207678_100075123 195
110 3300028381 Ga0268264_10606159 Ga0268264_106061591 195
111 3300032004 Ga0307414_10178276 Ga0307414_101782763 195
112 3300032133 Ga0316583_10088119 Ga0316583_100881192 195
113 3300039450 Ga0436363_1639024 Ga0436363_1639024_661_1248 195
114 3300048911 Ga0496108_0315590 Ga0496108_0315590_176_763 195
115 3300048916 Ga0496113_0290320 Ga0496113_0290320_88_675 195
116 3300050507 nmdc:mga05p37_89597_c1 nmdc:mga05p37_89597_c1_89_676 195
117 3300055283 Ga0500661_031083 Ga0500661_031083_301_888 195
118 3300005329 Ga0070683_100068705 Ga0070683_1000687051 196
119 3300005331 Ga0070670_100136911 Ga0070670_1001369112 196
120 3300005344 Ga0070661_100122811 Ga0070661_1001228112 196
121 3300005354 Ga0070675_100437233 Ga0070675_1004372332 196
122 3300005616 Ga0068852_100327939 Ga0068852_1003279392 196
123 3300006038 Ga0075365_10027229 Ga0075365_100272293 196
124 3300025920 Ga0207649_10020232 Ga0207649_100202323 196
125 3300025925 Ga0207650_10071801 Ga0207650_100718012 196
126 3300025944 Ga0207661_10029315 Ga0207661_100293154 196
127 3300025945 Ga0207679_10011725 Ga0207679_100117253 196
128 3300026041 Ga0207639_10200497 Ga0207639_102004971 196
129 3300050492 nmdc:mga0yw44_46299_c1 nmdc:mga0yw44_46299_c1_1732_2322 196
130 3300003187 JGI25151J46595_10031417 JGI25151J46595_100314173 197
131 3300005338 Ga0068868_100182676 Ga0068868_1001826763 197
132 3300005339 Ga0070660_100125933 Ga0070660_1001259333 197
133 3300005366 Ga0070659_100013306 Ga0070659_1000133068 197
134 3300005441 Ga0070700_100151288 Ga0070700_1001512883 197
135 3300005535 Ga0070684_100010044 Ga0070684_1000100446 197
136 3300005536 Ga0070697_100062006 Ga0070697_1000620063 197
137 3300005543 Ga0070672_100624256 Ga0070672_1006242561 197
138 3300005719 Ga0068861_100330663 Ga0068861_1003306632 197
139 3300005841 Ga0068863_100206084 Ga0068863_1002060843 197
140 3300005842 Ga0068858_100201538 Ga0068858_1002015383 197
141 3300013306 Ga0163162_10441455 Ga0163162_104414552 197
142 3300021358 Ga0213873_10077466 Ga0213873_100774662 197
143 3300025294 Ga0209025_1002097 Ga0209025_100209710 197
144 3300025315 Ga0207697_10002925 Ga0207697_100029257 197
145 3300025919 Ga0207657_10192872 Ga0207657_101928722 197
146 3300025926 Ga0207659_10052137 Ga0207659_100521373 197
147 3300025932 Ga0207690_10235235 Ga0207690_102352353 197
148 3300025936 Ga0207670_10095431 Ga0207670_100954313 197
149 3300028558 Ga0265326_10001037 Ga0265326_100010378 197
150 3300028794 Ga0307515_10000074 Ga0307515_10000074100 197
151 3300028800 Ga0265338_10021233 Ga0265338_100212333 197
152 3300031247 Ga0265340_10160126 Ga0265340_101601261 197
153 3300031711 Ga0265314_10017230 Ga0265314_100172303 197
154 3300037418 Ga0395900_0626452 Ga0395900_0626452_208_804 197
155 3300039453 Ga0436362_0012587 Ga0436362_0012587_316_912 197
156 3300048913 Ga0496110_0109695 Ga0496110_0109695_365_970 197
157 3300048924 Ga0496121_0235453 Ga0496121_0235453_380_973 197
158 3300049571 Ga0501034_0008497 Ga0501034_0008497_3556_4155 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

15

112

0.95

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

101

160

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6485 11 120
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6404 10 130
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6186 10 130
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6066 11 120
2xga-assembly1.cif.gz_B mtsl spin-labelled shigella flexneri spa15 0.5579 24 124
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9768 6 117 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9518 6 117 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.698 24 125 3.90.1150.30
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6511 7 110 3.90.1150.200
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6462 25 119 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7V9ZMH7-F1-model_v4 DUF1801 domain-containing protein 0.9931 6 130
AF-A0A6J7A2N7-F1-model_v4 Unannotated protein 0.9912 6 102
AF-A0A7V9ZMH7-F1-model_v4 DUF1801 domain-containing protein 0.9853 6 130
AF-A0A316DEU9-F1-model_v4 Uncharacterized protein DUF1801 0.9849 6 112
AF-A0A5C7FL00-F1-model_v4 deleted 0.9825 33 119

Feature Viewer

pLDDT pTM Quality
91.75 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map