F230632

General Info

Members Datasets Scaffolds Average Seq Length
158 133 316 188

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0151713|Ga0501031_0151713_663_1295
Length 210
Sequence MADDVSAAEADWLGLGAAAPVLRGDRVLLRAWRAEDLEPFGALNADPRVMEHYPARLTRAESDDLVRRVVPQFATRGFSLWAVEVPGVAPFIGYVGLVEPTFETRFTPCVEIGWRLAFPYWGQGYATEGARAVLSFGFEDAGLDEIVSFTAPANRRSVAVMERLNMTQDGEFNHPRLPQGHPLQRHVLYRLSKRRWQRDTVSNDTLKGHS

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
106 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
128 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
130 2643221569 Achromobacter sp. Root565 Isolate Unclassified
131 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
132 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
133 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.84
Metatranscriptomes 0.63
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 1.9
Rhizoplane 5.06
Rhizosphere 89.87
Stem 0
Stem Tuber 0
Unclassified 18.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0151713 3300049568 Bacteria 1514
2 JGI24739J22299_10034473 3300001989 Bacteria 1725
3 Ga0055530_10044484 3300003791 Bacteria 1064
4 Ga0070658_10599089 3300005327 Unclassified 955
5 Ga0070676_10015383 3300005328 Bacteria 4220
6 Ga0068869_100034674 3300005334 Bacteria 3572
7 Ga0070660_100067194 3300005339 Bacteria 2792
8 Ga0070671_100148492 3300005355 Bacteria 1979
9 Ga0070674_100827780 3300005356 Bacteria 801
10 Ga0070688_100534911 3300005365 Unclassified 889
11 Ga0070659_100710759 3300005366 Bacteria 869
12 Ga0070694_100149313 3300005444 Bacteria 1705
13 Ga0070662_100034861 3300005457 Unclassified 3551
14 Ga0070681_10399867 3300005458 Bacteria 1285
15 Ga0068867_100088734 3300005459 Unclassified 2344
16 Ga0068867_100165104 3300005459 Bacteria 1749
17 Ga0070698_100513936 3300005471 Bacteria 1136
18 Ga0070699_100000087 3300005518 Bacteria 88377
19 Ga0070699_100067337 3300005518 Bacteria 3110
20 Ga0070684_100335430 3300005535 Unclassified 1390
21 Ga0068853_100244871 3300005539 Unclassified 1644
22 Ga0070695_100105347 3300005545 Bacteria 1906
23 Ga0070696_100009076 3300005546 Bacteria 6660
24 Ga0070665_100193650 3300005548 Bacteria 2034
25 Ga0070665_100348975 3300005548 Bacteria 1485
26 Ga0068854_100307174 3300005578 Unclassified 1285
27 Ga0068854_100758933 3300005578 Bacteria 842
28 Ga0068852_100358673 3300005616 Unclassified 1425
29 Ga0068859_100043764 3300005617 Bacteria 4500
30 Ga0068859_100222344 3300005617 Unclassified 1976
31 Ga0068860_100106494 3300005843 Bacteria 2678
32 Ga0068862_100511553 3300005844 Unclassified 1141
33 Ga0070712_100006859 3300006175 Bacteria 7095
34 Ga0097621_100634498 3300006237 Bacteria 979
35 Ga0097620_100043764 3300006931 Bacteria 4500
36 Ga0097620_100222327 3300006931 Unclassified 1976
37 Ga0079104_1019125 3300006946 Bacteria 1922
38 Ga0111539_10000067 3300009094 Bacteria 105394
39 Ga0111539_11356062 3300009094 Unclassified 825
40 Ga0105245_10082977 3300009098 Bacteria 2933
41 Ga0105242_10044380 3300009176 Bacteria 3600
42 Ga0105248_10871353 3300009177 Bacteria 1017
43 Ga0105237_10237009 3300009545 Unclassified 1826
44 Ga0105249_10746338 3300009553 Bacteria 1041
45 Ga0157369_10263858 3300013105 Bacteria 1796
46 Ga0157369_10479673 3300013105 Bacteria 1287
47 Ga0157374_11927316 3300013296 Bacteria 617
48 Ga0157378_10363115 3300013297 Bacteria 1418
49 Ga0157378_10363484 3300013297 Bacteria 1417
50 Ga0206356_10165320 3300020070 Bacteria 761
51 Ga0207692_10072409 3300025898 Bacteria 1820
52 Ga0207645_10049662 3300025907 Bacteria 2679
53 Ga0207705_10064653 3300025909 Bacteria 2644
54 Ga0207693_10004144 3300025915 Bacteria 12299
55 Ga0207657_10059144 3300025919 Bacteria 3295
56 Ga0207686_10200117 3300025934 Bacteria 1430
57 Ga0207704_10002790 3300025938 Bacteria 7876
58 Ga0207689_10002696 3300025942 Bacteria 16423
59 Ga0207667_10520633 3300025949 Bacteria 1205
60 Ga0207640_10211551 3300025981 Unclassified 1478
61 Ga0207640_10868289 3300025981 Bacteria 786
62 Ga0207639_10560635 3300026041 Unclassified 1050
63 Ga0207648_10185345 3300026089 Bacteria 1843
64 Ga0207698_10050835 3300026142 Unclassified 3165
65 Ga0209281_1011917 3300027111 Bacteria 1929
66 Ga0207428_10000235 3300027907 Bacteria 75923
67 Ga0268266_11134175 3300028379 Bacteria 756
68 Ga0268265_10205188 3300028380 Unclassified 1713
69 Ga0268264_10192239 3300028381 Bacteria 1861
70 Ga0265318_10051322 3300028577 Bacteria 1549
71 Ga0265323_10070137 3300028653 Bacteria 1200
72 Ga0265338_10092407 3300028800 Bacteria 2496
73 Ga0265316_10322593 3300031344 Bacteria 1122
74 Ga0307513_10038189 3300031456 Bacteria 5334
75 Ga0307412_10001784 3300031911 Bacteria 11897
76 Ga0307411_10633234 3300032005 Unclassified 924
77 Ga0373942_0033059 3300035207 Bacteria 1378
78 Ga0373937_0498459 3300036401 Archaea 1157
79 Ga0395899_0033879 3300037312 Bacteria 3835
80 Ga0395900_0016725 3300037418 Bacteria 7481
81 Ga0395900_0073209 3300037418 Bacteria 3522
82 Ga0395898_0033027 3300037466 Bacteria 5165
83 Ga0395898_0055160 3300037466 Bacteria 3876
84 Ga0395905_0026909 3300037471 Bacteria 5424
85 Ga0395905_0046389 3300037471 Bacteria 4074
86 Ga0395901_0089899 3300038443 Bacteria 3213
87 Ga0395901_0126766 3300038443 Unclassified 2682
88 Ga0395901_0747013 3300038443 Bacteria 972
89 Ga0436361_0040566 3300039447 Bacteria 4922
90 Ga0466966_0079027 3300044684 Bacteria 2051
91 Ga0466961_0212017 3300044693 Bacteria 1195
92 Ga0466971_0114149 3300044719 Bacteria 1248
93 Ga0466957_0089453 3300044842 Bacteria 1927
94 Ga0466957_0128026 3300044842 Bacteria 1624
95 Ga0466957_0272753 3300044842 Bacteria 1130
96 Ga0466960_0491570 3300044901 Bacteria 718
97 Ga0466959_0300691 3300045049 Bacteria 1099
98 Ga0466958_0022742 3300045836 Bacteria 3675
99 Ga0466958_0040652 3300045836 Bacteria 2795
100 Ga0495603_0268920 3300046455 Bacteria 981
101 Ga0495662_0170347 3300046476 Bacteria 1073
102 Ga0495664_0204006 3300046477 Unclassified 1198
103 Ga0495596_0265831 3300046500 Unclassified 666
104 Ga0495608_0164652 3300046511 Unclassified 1409
105 Ga0495628_0137544 3300046516 Bacteria 1866
106 Ga0495624_0572143 3300046690 Bacteria 674
107 Ga0495676_0301158 3300047321 Bacteria 1081
108 Ga0496100_0318664 3300048903 Bacteria 1167
109 Ga0496101_0048648 3300048904 Bacteria 3048
110 Ga0496103_0412901 3300048906 Unclassified 867
111 Ga0496107_0087468 3300048910 Bacteria 2275
112 Ga0496109_0214757 3300048912 Bacteria 1809
113 Ga0496111_0392926 3300048914 Bacteria 1025
114 Ga0496111_0980992 3300048914 Bacteria 606
115 Ga0496114_0155831 3300048917 Bacteria 1983
116 Ga0501032_0116061 3300049569 Bacteria 1770
117 Ga0501032_0300358 3300049569 Unclassified 1038
118 Ga0501036_0682213 3300049572 Unclassified 849
119 Ga0501039_0096047 3300049575 Bacteria 2311
120 Ga0501040_0014610 3300049576 Bacteria 5178
121 Ga0501041_0044473 3300049577 Bacteria 2699
122 Ga0501042_0011568 3300049578 Bacteria 5958
123 Ga0501046_0178273 3300049580 Bacteria 1590
124 Ga0501067_0027923 3300049583 Bacteria 3127
125 Ga0501068_0209852 3300049584 Bacteria 1236
126 Ga0501069_0710765 3300049585 Bacteria 606
127 Ga0501070_0083401 3300049586 Bacteria 2646
128 Ga0501071_0097435 3300049587 Bacteria 2165
129 Ga0501072_0016785 3300049588 Bacteria 5622
130 Ga0501073_0056722 3300049589 Bacteria 2740
131 Ga0501073_0139310 3300049589 Bacteria 1681
132 Ga0501074_0272841 3300049590 Bacteria 1202
133 Ga0501075_0101046 3300049591 Bacteria 2190
134 Ga0501076_0115239 3300049592 Bacteria 2175
135 Ga0501076_0368196 3300049592 Bacteria 1181
136 Ga0501077_0138617 3300049593 Bacteria 1542
137 Ga0501079_0081365 3300049741 Bacteria 2504
138 Ga0501080_0165036 3300049742 Bacteria 2044
139 Ga0501080_0294018 3300049742 Bacteria 1474
140 Ga0501083_0024734 3300049744 Bacteria 4159
141 Ga0501083_0152677 3300049744 Unclassified 1512
142 Ga0501035_0209148 3300049822 Bacteria 1670
143 Ga0501045_0355789 3300049824 Bacteria 1090
144 nmdc:mga0qj67_463347_c1 3300050509 Unclassified 1020
145 nmdc:mga08y16_2451_c1 3300050511 Bacteria 19046
146 nmdc:mga0n895_236120_c1 3300050512 Bacteria 1855
147 Ga0495612_0045233 3300053078 Unclassified 1802
148 Ga0495619_0045858 3300053085 Bacteria 2873
149 Ga0495619_0102370 3300053085 Unclassified 1950
150 Ga0500651_0055438 3300053093 Bacteria 2483
151 Ga0501084_0039689 3300054114 Bacteria 3937
152 Ga0501082_0021016 3300060353 Bacteria 5630
153 Ga0466962_0409165 3300061719 Unclassified 680
154 Ga0530510_0321336 3300061734 Bacteria 1160
155 2643862551 2643221569 Bacteria 6064337
156 2765568851 2765235838 Bacteria 5445269
157 2839096268 2839094727 Bacteria 5534556
158 2889418248 2889415604 Bacteria 8048700
159 Ga0501031_0151713
160 JGI24739J22299_10034473
161 Ga0055530_10044484
162 Ga0070658_10599089
163 Ga0070676_10015383
164 Ga0068869_100034674
165 Ga0070660_100067194
166 Ga0070671_100148492
167 Ga0070674_100827780
168 Ga0070688_100534911
169 Ga0070659_100710759
170 Ga0070694_100149313
171 Ga0070662_100034861
172 Ga0070681_10399867
173 Ga0068867_100088734
174 Ga0068867_100165104
175 Ga0070698_100513936
176 Ga0070699_100000087
177 Ga0070699_100067337
178 Ga0070684_100335430
179 Ga0068853_100244871
180 Ga0070695_100105347
181 Ga0070696_100009076
182 Ga0070665_100193650
183 Ga0070665_100348975
184 Ga0068854_100307174
185 Ga0068854_100758933
186 Ga0068852_100358673
187 Ga0068859_100043764
188 Ga0068859_100222344
189 Ga0068860_100106494
190 Ga0068862_100511553
191 Ga0070712_100006859
192 Ga0097621_100634498
193 Ga0097620_100043764
194 Ga0097620_100222327
195 Ga0079104_1019125
196 Ga0111539_10000067
197 Ga0111539_11356062
198 Ga0105245_10082977
199 Ga0105242_10044380
200 Ga0105248_10871353
201 Ga0105237_10237009
202 Ga0105249_10746338
203 Ga0157369_10263858
204 Ga0157369_10479673
205 Ga0157374_11927316
206 Ga0157378_10363115
207 Ga0157378_10363484
208 Ga0206356_10165320
209 Ga0207692_10072409
210 Ga0207645_10049662
211 Ga0207705_10064653
212 Ga0207693_10004144
213 Ga0207657_10059144
214 Ga0207686_10200117
215 Ga0207704_10002790
216 Ga0207689_10002696
217 Ga0207667_10520633
218 Ga0207640_10211551
219 Ga0207640_10868289
220 Ga0207639_10560635
221 Ga0207648_10185345
222 Ga0207698_10050835
223 Ga0209281_1011917
224 Ga0207428_10000235
225 Ga0268266_11134175
226 Ga0268265_10205188
227 Ga0268264_10192239
228 Ga0265318_10051322
229 Ga0265323_10070137
230 Ga0265338_10092407
231 Ga0265316_10322593
232 Ga0307513_10038189
233 Ga0307412_10001784
234 Ga0307411_10633234
235 Ga0373942_0033059
236 Ga0373937_0498459
237 Ga0395899_0033879
238 Ga0395900_0016725
239 Ga0395900_0073209
240 Ga0395898_0033027
241 Ga0395898_0055160
242 Ga0395905_0026909
243 Ga0395905_0046389
244 Ga0395901_0089899
245 Ga0395901_0126766
246 Ga0395901_0747013
247 Ga0436361_0040566
248 Ga0466966_0079027
249 Ga0466961_0212017
250 Ga0466971_0114149
251 Ga0466957_0089453
252 Ga0466957_0128026
253 Ga0466957_0272753
254 Ga0466960_0491570
255 Ga0466959_0300691
256 Ga0466958_0022742
257 Ga0466958_0040652
258 Ga0495603_0268920
259 Ga0495662_0170347
260 Ga0495664_0204006
261 Ga0495596_0265831
262 Ga0495608_0164652
263 Ga0495628_0137544
264 Ga0495624_0572143
265 Ga0495676_0301158
266 Ga0496100_0318664
267 Ga0496101_0048648
268 Ga0496103_0412901
269 Ga0496107_0087468
270 Ga0496109_0214757
271 Ga0496111_0392926
272 Ga0496111_0980992
273 Ga0496114_0155831
274 Ga0501032_0116061
275 Ga0501032_0300358
276 Ga0501036_0682213
277 Ga0501039_0096047
278 Ga0501040_0014610
279 Ga0501041_0044473
280 Ga0501042_0011568
281 Ga0501046_0178273
282 Ga0501067_0027923
283 Ga0501068_0209852
284 Ga0501069_0710765
285 Ga0501070_0083401
286 Ga0501071_0097435
287 Ga0501072_0016785
288 Ga0501073_0056722
289 Ga0501073_0139310
290 Ga0501074_0272841
291 Ga0501075_0101046
292 Ga0501076_0115239
293 Ga0501076_0368196
294 Ga0501077_0138617
295 Ga0501079_0081365
296 Ga0501080_0165036
297 Ga0501080_0294018
298 Ga0501083_0024734
299 Ga0501083_0152677
300 Ga0501035_0209148
301 Ga0501045_0355789
302 nmdc:mga0qj67_463347_c1
303 nmdc:mga08y16_2451_c1
304 nmdc:mga0n895_236120_c1
305 Ga0495612_0045233
306 Ga0495619_0045858
307 Ga0495619_0102370
308 Ga0500651_0055438
309 Ga0501084_0039689
310 Ga0501082_0021016
311 Ga0466962_0409165
312 Ga0530510_0321336
313 2643862551
314 2765568851
315 2839096268
316 2889418248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

26

167

0.93

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

45

166

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6edd-assembly2.cif.gz_B crystal structure of a gnat superfamily pa3944 acetyltransferase in complex with coa (p1 space group) 0.963 3 182
7kpp-assembly1.cif.gz_A structure of the e102a mutant of a gnat superfamily pa3944 acetyltransferase 0.9578 1 182
6edd-assembly2.cif.gz_B crystal structure of a gnat superfamily pa3944 acetyltransferase in complex with coa (p1 space group) 0.9377 3 182
3fbu-assembly2.cif.gz_A the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.871 3 178
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.8652 127 176
ID Description Score Start End Superfamily
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9289 3 180 3.40.630.30
af_Q2G0B8_3_165_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9229 4 163 3.40.630.30
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9135 3 180 3.40.630.30
af_Q2G0B8_3_165_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.901 4 163 3.40.630.30
af_Q2FUT4_1_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.89 4 155 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7Z6XR88-F1-model_v4 deleted 0.9947 82 183
AF-A0A363RPN9-F1-model_v4 GNAT family N-acetyltransferase 0.9925 3 182 GO:0016747
AF-A0A434KVU6-F1-model_v4 N-acetyltransferase 0.9922 116 184 GO:0016747
AF-A0A1B7HV03-F1-model_v4 GNAT family acetyltransferase 0.9909 3 176 GO:0016747
AF-A0A538I609-F1-model_v4 GNAT family N-acetyltransferase 0.9908 3 183 GO:0016747

Map