F230036

General Info

Members Datasets Scaffolds Average Seq Length
158 101 316 151

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10119781|Ga0265314_101197812
Length 148
Sequence MNITGTVDSVLNQKPPQLWTIRPEATVFEAIQLMADKNIGALPVMLNEKLVGVFSERDYTRKIALKGRSSKQTPVREVLSDVYSVEPETSVEDCMRLMTENRVRHLPVIDGDELIGMVSIGDLVNWTISVQHVALNQMADYISGKYPG

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
84 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.27
Rhizosphere 96.2
Stem 0
Stem Tuber 0
Unclassified 44.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10119781 3300031711 Bacteria 1659
2 LJNas_1010544 3300000546 Bacteria 985
3 Ga0058860_11466036 3300004801 Unclassified 678
4 Ga0065715_10330418 3300005293 Unclassified 985
5 Ga0065707_10406105 3300005295 Unclassified 847
6 Ga0070690_100241332 3300005330 Unclassified 1274
7 Ga0070690_100255027 3300005330 Unclassified 1242
8 Ga0070670_101183464 3300005331 Unclassified 698
9 Ga0070689_100016216 3300005340 Bacteria 5447
10 Ga0070689_100909699 3300005340 Bacteria 779
11 Ga0070689_101230748 3300005340 Unclassified 673
12 Ga0070687_100256396 3300005343 Unclassified 1089
13 Ga0070687_100475830 3300005343 Bacteria 836
14 Ga0070668_100580761 3300005347 Bacteria 978
15 Ga0070675_100752535 3300005354 Bacteria 889
16 Ga0070673_100591484 3300005364 Unclassified 1011
17 Ga0070688_100177780 3300005365 Bacteria 1474
18 Ga0070688_100339268 3300005365 Bacteria 1097
19 Ga0070688_101197417 3300005365 Unclassified 610
20 Ga0070713_100041100 3300005436 Bacteria 3765
21 Ga0070711_100808859 3300005439 Unclassified 795
22 Ga0070700_100856764 3300005441 Unclassified 736
23 Ga0070694_101191160 3300005444 Bacteria 638
24 Ga0070708_101388685 3300005445 Unclassified 655
25 Ga0070685_10079003 3300005466 Bacteria 1968
26 Ga0070685_10905498 3300005466 Unclassified 657
27 Ga0070698_100667980 3300005471 Unclassified 980
28 Ga0070698_101121984 3300005471 Bacteria 735
29 Ga0070704_100698082 3300005549 Unclassified 900
30 Ga0068857_100029363 3300005577 Unclassified 4852
31 Ga0068857_100159858 3300005577 Bacteria 2044
32 Ga0070702_100022879 3300005615 Unclassified 3313
33 Ga0068859_100087128 3300005617 Bacteria 3170
34 Ga0068859_100251327 3300005617 Bacteria 1859
35 Ga0068859_100432772 3300005617 Bacteria 1412
36 Ga0068859_100539416 3300005617 Unclassified 1261
37 Ga0068859_101867830 3300005617 Unclassified 663
38 Ga0068863_100018306 3300005841 Bacteria 6707
39 Ga0068863_101459389 3300005841 Unclassified 692
40 Ga0070717_10043155 3300006028 Bacteria 3680
41 Ga0070717_10241855 3300006028 Bacteria 1592
42 Ga0075432_10194118 3300006058 Unclassified 800
43 Ga0068871_100073104 3300006358 Bacteria 2826
44 Ga0075431_100026937 3300006847 Bacteria 5897
45 Ga0075433_10198473 3300006852 Unclassified 1784
46 Ga0075433_10697500 3300006852 Unclassified 889
47 Ga0075433_11578007 3300006852 Unclassified 566
48 Ga0075434_100004622 3300006871 Bacteria 12439
49 Ga0075434_101128722 3300006871 Unclassified 797
50 Ga0075429_100035156 3300006880 Bacteria 4357
51 Ga0075429_100088443 3300006880 Bacteria 2700
52 Ga0097620_100087126 3300006931 Bacteria 3170
53 Ga0097620_100251325 3300006931 Bacteria 1859
54 Ga0097620_100432725 3300006931 Bacteria 1412
55 Ga0097620_100539425 3300006931 Unclassified 1261
56 Ga0097620_101867451 3300006931 Unclassified 663
57 Ga0075435_100196517 3300007076 Unclassified 1708
58 Ga0075435_100333709 3300007076 Bacteria 1299
59 Ga0099794_10272863 3300007265 Bacteria 874
60 Ga0111539_10100089 3300009094 Unclassified 3404
61 Ga0111539_10514795 3300009094 Unclassified 1394
62 Ga0111539_10843014 3300009094 Bacteria 1066
63 Ga0111539_11405486 3300009094 Bacteria 809
64 Ga0111539_11459238 3300009094 Unclassified 793
65 Ga0105245_10126853 3300009098 Bacteria 2390
66 Ga0105245_10161004 3300009098 Unclassified 2130
67 Ga0105247_11157220 3300009101 Unclassified 613
68 Ga0114129_10001113 3300009147 Bacteria 35446
69 Ga0105243_11089698 3300009148 Unclassified 806
70 Ga0105242_10082329 3300009176 Bacteria 2693
71 Ga0105242_10241749 3300009176 Bacteria 1623
72 Ga0105248_10271142 3300009177 Unclassified 1911
73 Ga0105238_10029800 3300009551 Bacteria 5558
74 Ga0105246_10398562 3300011119 Unclassified 1142
75 Ga0157374_11342796 3300013296 Unclassified 737
76 Ga0157378_10514682 3300013297 Unclassified 1197
77 Ga0163162_13192494 3300013306 Unclassified 526
78 Ga0157375_10000733 3300013308 Bacteria 28954
79 Ga0157375_10536173 3300013308 Bacteria 1333
80 Ga0163163_10611289 3300014325 Bacteria 1153
81 Ga0163163_11029886 3300014325 Unclassified 886
82 Ga0157376_10152113 3300014969 Bacteria 2088
83 Ga0157376_11424899 3300014969 Bacteria 725
84 Ga0163161_11795266 3300017792 Unclassified 545
85 Ga0213876_10563509 3300021384 Unclassified 606
86 Ga0207710_10587774 3300025900 Unclassified 581
87 Ga0207680_10094937 3300025903 Unclassified 1905
88 Ga0207663_10617900 3300025916 Unclassified 853
89 Ga0207646_10408529 3300025922 Bacteria 1226
90 Ga0207687_10259386 3300025927 Bacteria 1385
91 Ga0207687_10336806 3300025927 Unclassified 1225
92 Ga0207700_10004219 3300025928 Bacteria 8441
93 Ga0207700_10170644 3300025928 Bacteria 1815
94 Ga0207670_10005856 3300025936 Bacteria 6786
95 Ga0207670_10150213 3300025936 Bacteria 1728
96 Ga0207670_10805783 3300025936 Bacteria 783
97 Ga0207704_10138243 3300025938 Bacteria 1700
98 Ga0207711_10412278 3300025941 Unclassified 1256
99 Ga0207712_10447874 3300025961 Bacteria 1094
100 Ga0207712_10881305 3300025961 Bacteria 790
101 Ga0207677_10123060 3300026023 Unclassified 1955
102 Ga0207641_10107913 3300026088 Bacteria 2463
103 Ga0207641_11419347 3300026088 Unclassified 695
104 Ga0207674_10039839 3300026116 Unclassified 4869
105 Ga0207674_11464330 3300026116 Unclassified 652
106 Ga0207675_100618601 3300026118 Bacteria 1087
107 Ga0265338_10000009 3300028800 Bacteria 448611
108 Ga0265338_10000240 3300028800 Bacteria 101444
109 Ga0265338_10239482 3300028800 Unclassified 1344
110 Ga0265338_10546543 3300028800 Unclassified 811
111 Ga0265324_10005381 3300029957 Bacteria 5540
112 Ga0265320_10037543 3300031240 Bacteria 2439
113 Ga0265331_10054030 3300031250 Bacteria 1914
114 Ga0265316_10127692 3300031344 Unclassified 1917
115 Ga0307513_10351631 3300031456 Unclassified 1221
116 Ga0307408_100569730 3300031548 Bacteria 1002
117 Ga0265314_10232091 3300031711 Bacteria 1070
118 Ga0373953_0398403 3300035117 Unclassified 606
119 Ga0373943_0061875 3300035170 Bacteria 1873
120 Ga0373927_0012026 3300035695 Bacteria 5757
121 Ga0373933_0420159 3300035724 Unclassified 873
122 Ga0373947_0017233 3300035725 Bacteria 4154
123 Ga0373937_0093644 3300036401 Unclassified 2786
124 Ga0373925_0001908 3300037068 Bacteria 17300
125 Ga0436365_0356979 3300039437 Bacteria 663
126 Ga0436362_0574238 3300039453 Unclassified 2232
127 Ga0451791_0242490 3300041451 Unclassified 692
128 Ga0451804_1128210 3300041463 Unclassified 979
129 Ga0453684_0017200 3300044712 Bacteria 11230
130 Ga0451576_0187369 3300045051 Bacteria 2160
131 Ga0451576_0299830 3300045051 Bacteria 1681
132 Ga0451576_0346009 3300045051 Bacteria 1556
133 Ga0451576_0739876 3300045051 Unclassified 1033
134 Ga0451576_1724609 3300045051 Unclassified 648
135 Ga0451576_1743200 3300045051 Bacteria 644
136 Ga0451576_1901945 3300045051 Unclassified 614
137 Ga0495630_0136002 3300046517 Bacteria 1867
138 Ga0495666_0054652 3300046526 Unclassified 1915
139 Ga0495645_0017207 3300046543 Bacteria 5178
140 Ga0495645_0117182 3300046543 Bacteria 1879
141 Ga0495645_0333303 3300046543 Unclassified 982
142 Ga0495657_0033774 3300046675 Bacteria 3559
143 Ga0495599_0105867 3300046678 Archaea 1752
144 Ga0495613_0623781 3300046689 Bacteria 716
145 Ga0495624_0068508 3300046690 Bacteria 2212
146 Ga0501046_0660303 3300049580 Bacteria 739
147 nmdc:mga05p37_594_c1 3300050507 Bacteria 39864
148 nmdc:mga09592_20828_c2 3300050508 Bacteria 2186
149 nmdc:mga06r32_1983277_c1 3300050510 Bacteria 516
150 nmdc:mga08y16_1837013_c1 3300050511 Bacteria 558
151 nmdc:mga08y16_769139_c1 3300050511 Unclassified 958
152 nmdc:mga0n895_171464_c1 3300050512 Unclassified 2202
153 nmdc:mga0n895_18277_c1 3300050512 Bacteria 6482
154 nmdc:mga0n895_502558_c1 3300050512 Bacteria 1221
155 nmdc:mga0a205_1332013_c1 3300050515 Unclassified 566
156 nmdc:mga0a205_648239_c1 3300050515 Bacteria 907
157 nmdc:mga0a205_7086_c2 3300050515 Bacteria 6370
158 Ga0495595_0176760 3300053084 Bacteria 1058
159 Ga0265314_10119781
160 LJNas_1010544
161 Ga0058860_11466036
162 Ga0065715_10330418
163 Ga0065707_10406105
164 Ga0070690_100241332
165 Ga0070690_100255027
166 Ga0070670_101183464
167 Ga0070689_100016216
168 Ga0070689_100909699
169 Ga0070689_101230748
170 Ga0070687_100256396
171 Ga0070687_100475830
172 Ga0070668_100580761
173 Ga0070675_100752535
174 Ga0070673_100591484
175 Ga0070688_100177780
176 Ga0070688_100339268
177 Ga0070688_101197417
178 Ga0070713_100041100
179 Ga0070711_100808859
180 Ga0070700_100856764
181 Ga0070694_101191160
182 Ga0070708_101388685
183 Ga0070685_10079003
184 Ga0070685_10905498
185 Ga0070698_100667980
186 Ga0070698_101121984
187 Ga0070704_100698082
188 Ga0068857_100029363
189 Ga0068857_100159858
190 Ga0070702_100022879
191 Ga0068859_100087128
192 Ga0068859_100251327
193 Ga0068859_100432772
194 Ga0068859_100539416
195 Ga0068859_101867830
196 Ga0068863_100018306
197 Ga0068863_101459389
198 Ga0070717_10043155
199 Ga0070717_10241855
200 Ga0075432_10194118
201 Ga0068871_100073104
202 Ga0075431_100026937
203 Ga0075433_10198473
204 Ga0075433_10697500
205 Ga0075433_11578007
206 Ga0075434_100004622
207 Ga0075434_101128722
208 Ga0075429_100035156
209 Ga0075429_100088443
210 Ga0097620_100087126
211 Ga0097620_100251325
212 Ga0097620_100432725
213 Ga0097620_100539425
214 Ga0097620_101867451
215 Ga0075435_100196517
216 Ga0075435_100333709
217 Ga0099794_10272863
218 Ga0111539_10100089
219 Ga0111539_10514795
220 Ga0111539_10843014
221 Ga0111539_11405486
222 Ga0111539_11459238
223 Ga0105245_10126853
224 Ga0105245_10161004
225 Ga0105247_11157220
226 Ga0114129_10001113
227 Ga0105243_11089698
228 Ga0105242_10082329
229 Ga0105242_10241749
230 Ga0105248_10271142
231 Ga0105238_10029800
232 Ga0105246_10398562
233 Ga0157374_11342796
234 Ga0157378_10514682
235 Ga0163162_13192494
236 Ga0157375_10000733
237 Ga0157375_10536173
238 Ga0163163_10611289
239 Ga0163163_11029886
240 Ga0157376_10152113
241 Ga0157376_11424899
242 Ga0163161_11795266
243 Ga0213876_10563509
244 Ga0207710_10587774
245 Ga0207680_10094937
246 Ga0207663_10617900
247 Ga0207646_10408529
248 Ga0207687_10259386
249 Ga0207687_10336806
250 Ga0207700_10004219
251 Ga0207700_10170644
252 Ga0207670_10005856
253 Ga0207670_10150213
254 Ga0207670_10805783
255 Ga0207704_10138243
256 Ga0207711_10412278
257 Ga0207712_10447874
258 Ga0207712_10881305
259 Ga0207677_10123060
260 Ga0207641_10107913
261 Ga0207641_11419347
262 Ga0207674_10039839
263 Ga0207674_11464330
264 Ga0207675_100618601
265 Ga0265338_10000009
266 Ga0265338_10000240
267 Ga0265338_10239482
268 Ga0265338_10546543
269 Ga0265324_10005381
270 Ga0265320_10037543
271 Ga0265331_10054030
272 Ga0265316_10127692
273 Ga0307513_10351631
274 Ga0307408_100569730
275 Ga0265314_10232091
276 Ga0373953_0398403
277 Ga0373943_0061875
278 Ga0373927_0012026
279 Ga0373933_0420159
280 Ga0373947_0017233
281 Ga0373937_0093644
282 Ga0373925_0001908
283 Ga0436365_0356979
284 Ga0436362_0574238
285 Ga0451791_0242490
286 Ga0451804_1128210
287 Ga0453684_0017200
288 Ga0451576_0187369
289 Ga0451576_0299830
290 Ga0451576_0346009
291 Ga0451576_0739876
292 Ga0451576_1724609
293 Ga0451576_1743200
294 Ga0451576_1901945
295 Ga0495630_0136002
296 Ga0495666_0054652
297 Ga0495645_0017207
298 Ga0495645_0117182
299 Ga0495645_0333303
300 Ga0495657_0033774
301 Ga0495599_0105867
302 Ga0495613_0623781
303 Ga0495624_0068508
304 Ga0501046_0660303
305 nmdc:mga05p37_594_c1
306 nmdc:mga09592_20828_c2
307 nmdc:mga06r32_1983277_c1
308 nmdc:mga08y16_1837013_c1
309 nmdc:mga08y16_769139_c1
310 nmdc:mga0n895_171464_c1
311 nmdc:mga0n895_18277_c1
312 nmdc:mga0n895_502558_c1
313 nmdc:mga0a205_1332013_c1
314 nmdc:mga0a205_648239_c1
315 nmdc:mga0a205_7086_c2
316 Ga0495595_0176760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

75

129

0.91

PF00571

CBS

CBS domain

7

65

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9638 7 130
4fry-assembly1.cif.gz_A the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 0.9592 6 133
3ghd-assembly1.cif.gz_A crystal structure of a cystathionine beta-synthase domain protein fused to a zn-ribbon-like domain 0.9569 21 84
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.9513 6 130
3fhm-assembly2.cif.gz_B crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9476 6 127
ID Description Score Start End Superfamily
af_Q75K17_104_256_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9647 5 145 3.10.580.10
af_P71737_1_141_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9645 7 145 3.10.580.10
af_O13965_237_391_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9621 7 129 3.10.580.10
4fryA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9592 6 133 3.10.580.10
af_K7KHU5_50_204_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9514 1 148 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A7C4BV57-F1-model_v4 CBS domain-containing protein 0.9883 7 135
AF-A0A6L7PI76-F1-model_v4 deleted 0.9879 6 145
AF-A0A523M7I1-F1-model_v4 CBS domain-containing protein 0.9869 6 148
AF-A0A838FTB4-F1-model_v4 CBS domain-containing protein 0.9863 3 134
AF-A0A4V3DLN2-F1-model_v4 CBS domain protein 0.9857 7 145

Map