F226784

General Info

Members Datasets Scaffolds Average Seq Length
157 119 156 183

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100274010|Ga0070665_1002740102
Length 209
Sequence MIAKTAAIERGSQPSPLQPSNYESEKGKIQFRMNIVYFDLETQRTANDVGGWDRKRDMGMSLGVTYCTNLTEYRIYPESRVHDLIQQLLRADLVVGFNVVNFDYQVLMGYTILDLPHQLRTLDLLVEIEKTLGNKPRLDNIAHATLGVGKTADGVDAIKWWREKRVMDIAEYCCFDVKVTKLVHEHGLQHRELFYTDKFSRKQRVDIKW

Samples

Sample ID Description Type Environment
1 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
115 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 0
Rhizoplane 1.27
Rhizosphere 86.62
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10002380 3300001991 Bacteria 2822
2 JGI24033J26618_1000023 3300002155 Bacteria 23875
3 rootH2_10009508 3300003320 Bacteria 78035
4 rootL2_10099647 3300003322 Bacteria 3770
5 rootH1_10064317 3300003323 Bacteria 25294
6 Ga0065707_10418133 3300005295 Unclassified 834
7 Ga0070690_100597513 3300005330 Bacteria 837
8 Ga0070689_100025610 3300005340 Unclassified 4433
9 Ga0070661_100002798 3300005344 Bacteria 11972
10 Ga0070668_100207477 3300005347 Bacteria 1610
11 Ga0070671_100076256 3300005355 Bacteria 2801
12 Ga0070688_100028779 3300005365 Bacteria 3321
13 Ga0070659_100015897 3300005366 Bacteria 5645
14 Ga0070709_10442481 3300005434 Unclassified 978
15 Ga0070714_101442976 3300005435 Unclassified 672
16 Ga0070713_101428408 3300005436 Unclassified 671
17 Ga0070705_100646835 3300005440 Bacteria 824
18 Ga0070678_100062666 3300005456 Bacteria 2747
19 Ga0070706_100002718 3300005467 Bacteria 17695
20 Ga0070706_100418244 3300005467 Bacteria 1247
21 Ga0070707_100017251 3300005468 Bacteria 6786
22 Ga0070707_100892929 3300005468 Bacteria 853
23 Ga0070698_100027409 3300005471 Bacteria 5925
24 Ga0070699_100030012 3300005518 Unclassified 4691
25 Ga0070697_100003621 3300005536 Bacteria 11866
26 Ga0070697_100016275 3300005536 Bacteria 5848
27 Ga0070697_100140543 3300005536 Bacteria 2030
28 Ga0070672_100818213 3300005543 Bacteria 820
29 Ga0070686_100003344 3300005544 Bacteria 8785
30 Ga0070665_100274010 3300005548 Bacteria 1689
31 Ga0070704_100635076 3300005549 Bacteria 941
32 Ga0068856_100000313 3300005614 Bacteria 53232
33 Ga0068859_101299735 3300005617 Unclassified 802
34 Ga0068859_101345063 3300005617 Unclassified 787
35 Ga0081540_1010293 3300005983 Bacteria 6345
36 Ga0070717_10275425 3300006028 Unclassified 1491
37 Ga0070717_10355335 3300006028 Bacteria 1311
38 Ga0070715_10232406 3300006163 Unclassified 954
39 Ga0075362_10000439 3300006177 Bacteria 12068
40 Ga0075370_10004823 3300006353 Bacteria 6608
41 Ga0075436_100334831 3300006914 Bacteria 1089
42 Ga0097620_101299767 3300006931 Unclassified 802
43 Ga0075435_100923530 3300007076 Unclassified 761
44 Ga0105240_10004550 3300009093 Bacteria 21050
45 Ga0105240_10928198 3300009093 Bacteria 935
46 Ga0105240_11228996 3300009093 Unclassified 792
47 Ga0111539_10089799 3300009094 Bacteria 3611
48 Ga0105247_10877773 3300009101 Unclassified 691
49 Ga0114129_12121605 3300009147 Bacteria 677
50 Ga0105242_10024721 3300009176 Unclassified 4746
51 Ga0157374_10282333 3300013296 Unclassified 1639
52 Ga0157378_10016377 3300013297 Bacteria 6491
53 Ga0157378_10188538 3300013297 Bacteria 1944
54 Ga0157378_10190211 3300013297 Bacteria 1935
55 Ga0157378_10222160 3300013297 Bacteria 1796
56 Ga0163162_10085458 3300013306 Bacteria 3232
57 Ga0157376_10276649 3300014969 Bacteria 1579
58 Ga0163161_10776288 3300017792 Bacteria 803
59 Ga0213872_10002031 3300021361 Bacteria 12296
60 Ga0213872_10002976 3300021361 Bacteria 9583
61 Ga0213876_10001222 3300021384 Bacteria 16220
62 Ga0213871_10077000 3300021441 Unclassified 950
63 Ga0209050_1001605 3300025298 Bacteria 23289
64 Ga0207688_10008111 3300025901 Bacteria 5709
65 Ga0207684_10127704 3300025910 Unclassified 2182
66 Ga0207684_10840696 3300025910 Bacteria 774
67 Ga0207693_10079938 3300025915 Bacteria 2559
68 Ga0207693_10459357 3300025915 Unclassified 995
69 Ga0207663_10792280 3300025916 Unclassified 754
70 Ga0207649_10002480 3300025920 Bacteria 10312
71 Ga0207700_10211233 3300025928 Bacteria 1641
72 Ga0207644_10089269 3300025931 Bacteria 2294
73 Ga0207690_10009770 3300025932 Bacteria 5701
74 Ga0207706_10531390 3300025933 Bacteria 1013
75 Ga0207686_10025841 3300025934 Unclassified 3422
76 Ga0207668_10029396 3300025972 Bacteria 3602
77 Ga0207702_10001517 3300026078 Bacteria 22953
78 Ga0207641_10673866 3300026088 Bacteria 1017
79 Ga0207683_10086101 3300026121 Bacteria 2794
80 Ga0207683_10718541 3300026121 Unclassified 926
81 Ga0265338_10005547 3300028800 Bacteria 16422
82 Ga0265338_10134255 3300028800 Bacteria 1949
83 Ga0265338_10153581 3300028800 Bacteria 1786
84 Ga0265338_10273801 3300028800 Bacteria 1236
85 Ga0265324_10213993 3300029957 Unclassified 654
86 Ga0265329_10000096 3300031242 Bacteria 41415
87 Ga0265316_10138433 3300031344 Bacteria 1830
88 Ga0307408_100627966 3300031548 Bacteria 958
89 Ga0265314_10000046 3300031711 Bacteria 199789
90 Ga0307412_10080047 3300031911 Bacteria 2256
91 Ga0307409_100902965 3300031995 Unclassified 897
92 Ga0307416_100071983 3300032002 Bacteria 2875
93 Ga0373936_0396958 3300035113 Unclassified 633
94 Ga0373935_0028161 3300035692 Bacteria 3473
95 Ga0373927_0016965 3300035695 Bacteria 4799
96 Ga0373947_0016237 3300035725 Unclassified 4279
97 Ga0373925_0015348 3300037068 Bacteria 5541
98 Ga0395899_0000022 3300037312 Bacteria 378509
99 Ga0395898_0000012 3300037466 Bacteria 480882
100 Ga0395905_0548171 3300037471 Unclassified 1058
101 Ga0436365_0363601 3300039437 Bacteria 58813
102 Ga0436365_0446114 3300039437 Unclassified 1288
103 Ga0436365_1120348 3300039437 Bacteria 27692
104 Ga0436360_0483307 3300039438 Bacteria 6779
105 Ga0436360_0560040 3300039438 Bacteria 5174
106 Ga0436361_0186997 3300039447 Unclassified 2968
107 Ga0436361_0251078 3300039447 Bacteria 11973
108 Ga0436361_0317879 3300039447 Unclassified 2020
109 Ga0436361_0416209 3300039447 Unclassified 668
110 Ga0436361_0971225 3300039447 Bacteria 2342
111 Ga0436361_1222092 3300039447 Bacteria 7801
112 Ga0451807_2097684 3300041486 Bacteria 637
113 Ga0451853_0422862 3300041512 Bacteria 682
114 Ga0451577_0010736 3300042876 Bacteria 8718
115 Ga0466965_0004178 3300044683 Bacteria 6418
116 Ga0466963_0242469 3300044694 Bacteria 1264
117 Ga0453684_0007358 3300044712 Bacteria 20312
118 Ga0466971_0000040 3300044719 Bacteria 51554
119 Ga0466968_0091410 3300044735 Bacteria 1349
120 Ga0466957_0011627 3300044842 Bacteria 5085
121 Ga0466957_0035399 3300044842 Bacteria 2996
122 Ga0495641_0017575 3300046461 Bacteria 3722
123 Ga0495630_0187658 3300046517 Unclassified 1577
124 Ga0495630_0935077 3300046517 Bacteria 660
125 Ga0496103_0308056 3300048906 Bacteria 1019
126 Ga0496121_0084004 3300048924 Unclassified 2512
127 Ga0501296_019834 3300049519 Unclassified 854
128 Ga0501031_0000297 3300049568 Bacteria 28384
129 Ga0501032_0000027 3300049569 Bacteria 136304
130 Ga0501032_0038115 3300049569 Unclassified 3275
131 Ga0501033_0000002 3300049570 Bacteria 668574
132 Ga0501033_0000015 3300049570 Bacteria 218502
133 Ga0501033_0248577 3300049570 Bacteria 1261
134 Ga0501034_0030653 3300049571 Bacteria 5466
135 Ga0501037_0000044 3300049573 Bacteria 117895
136 Ga0501038_0000020 3300049574 Bacteria 152738
137 Ga0501038_0002151 3300049574 Bacteria 18300
138 Ga0501038_0233386 3300049574 Bacteria 1463
139 Ga0501039_0008427 3300049575 Bacteria 7857
140 Ga0501043_0001036 3300049579 Bacteria 24402
141 Ga0501047_0000900 3300049581 Bacteria 30326
142 Ga0501068_0549513 3300049584 Bacteria 751
143 Ga0501070_0002044 3300049586 Bacteria 17743
144 Ga0501035_0000001 3300049822 Bacteria 1037138
145 Ga0501044_0005675 3300049823 Bacteria 13834
146 Ga0501044_0135379 3300049823 Unclassified 2455
147 Ga0501044_0226044 3300049823 Unclassified 1821
148 Ga0501044_0406426 3300049823 Bacteria 1273
149 nmdc:mga03683_761_c1 3300050489 Bacteria 9242
150 nmdc:mga03n38_23674_c1 3300050490 Bacteria 2502
151 nmdc:mga03n38_474919_c1 3300050490 Unclassified 698
152 nmdc:mga0k408_12003_c1 3300050493 Bacteria 4727
153 nmdc:mga0k408_12577_c1 3300050493 Bacteria 4628
154 nmdc:mga07m45_1439_c2 3300050496 Bacteria 9799
155 nmdc:mga09592_499394_c1 3300050508 Unclassified 1047
156 Ga0466962_0000003 3300061719 Bacteria 187594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0187658 Ga0495630_0187658_1101_1556 151
2 3300046517 Ga0495630_0935077 Ga0495630_0935077_192_647 151
3 3300049519 Ga0501296_019834 Ga0501296_019834_18_473 151
4 3300049823 Ga0501044_0135379 Ga0501044_0135379_20_475 151
5 3300025934 Ga0207686_10025841 Ga0207686_100258412 165
6 3300005467 Ga0070706_100002718 Ga0070706_10000271816 167
7 3300005468 Ga0070707_100892929 Ga0070707_1008929291 167
8 3300025910 Ga0207684_10127704 Ga0207684_101277042 167
9 3300039447 Ga0436361_1222092 Ga0436361_1222092_2362_2898 169
10 3300039438 Ga0436360_0483307 Ga0436360_0483307_207_740 171
11 3300039447 Ga0436361_0971225 Ga0436361_0971225_58_591 171
12 3300028800 Ga0265338_10153581 Ga0265338_101535812 176
13 iso_pu_bacteria 2786546548 2787507517 176
14 3300005340 Ga0070689_100025610 Ga0070689_1000256102 177
15 3300005434 Ga0070709_10442481 Ga0070709_104424811 177
16 3300005435 Ga0070714_101442976 Ga0070714_1014429761 177
17 3300005436 Ga0070713_101428408 Ga0070713_1014284081 177
18 3300005440 Ga0070705_100646835 Ga0070705_1006468351 177
19 3300005467 Ga0070706_100418244 Ga0070706_1004182441 177
20 3300005468 Ga0070707_100017251 Ga0070707_1000172512 177
21 3300005471 Ga0070698_100027409 Ga0070698_1000274093 177
22 3300005518 Ga0070699_100030012 Ga0070699_1000300122 177
23 3300005536 Ga0070697_100003621 Ga0070697_1000036218 177
24 3300005536 Ga0070697_100016275 Ga0070697_1000162753 177
25 3300005536 Ga0070697_100140543 Ga0070697_1001405432 177
26 3300005544 Ga0070686_100003344 Ga0070686_1000033444 177
27 3300005549 Ga0070704_100635076 Ga0070704_1006350762 177
28 3300006028 Ga0070717_10275425 Ga0070717_102754252 177
29 3300006163 Ga0070715_10232406 Ga0070715_102324062 177
30 3300006914 Ga0075436_100334831 Ga0075436_1003348312 177
31 3300009093 Ga0105240_11228996 Ga0105240_112289961 177
32 3300009094 Ga0111539_10089799 Ga0111539_100897994 177
33 3300013296 Ga0157374_10282333 Ga0157374_102823332 177
34 3300013297 Ga0157378_10188538 Ga0157378_101885382 177
35 3300013297 Ga0157378_10190211 Ga0157378_101902112 177
36 3300014969 Ga0157376_10276649 Ga0157376_102766492 177
37 3300021384 Ga0213876_10001222 Ga0213876_1000122212 177
38 3300025910 Ga0207684_10840696 Ga0207684_108406961 177
39 3300025915 Ga0207693_10079938 Ga0207693_100799383 177
40 3300025916 Ga0207663_10792280 Ga0207663_107922801 177
41 3300025928 Ga0207700_10211233 Ga0207700_102112332 177
42 3300026088 Ga0207641_10673866 Ga0207641_106738661 177
43 3300028800 Ga0265338_10005547 Ga0265338_1000554715 177
44 3300028800 Ga0265338_10134255 Ga0265338_101342553 177
45 3300028800 Ga0265338_10273801 Ga0265338_102738012 177
46 3300029957 Ga0265324_10213993 Ga0265324_102139931 177
47 3300031242 Ga0265329_10000096 Ga0265329_1000009613 177
48 3300031344 Ga0265316_10138433 Ga0265316_101384332 177
49 3300031711 Ga0265314_10000046 Ga0265314_1000004620 177
50 3300035113 Ga0373936_0396958 Ga0373936_0396958_34_567 177
51 3300035692 Ga0373935_0028161 Ga0373935_0028161_2664_3197 177
52 3300035695 Ga0373927_0016965 Ga0373927_0016965_435_968 177
53 3300035725 Ga0373947_0016237 Ga0373947_0016237_2232_2765 177
54 3300037068 Ga0373925_0015348 Ga0373925_0015348_355_888 177
55 3300037471 Ga0395905_0548171 Ga0395905_0548171_96_629 177
56 3300039437 Ga0436365_0363601 Ga0436365_0363601_44025_44558 177
57 3300039437 Ga0436365_0446114 Ga0436365_0446114_207_740 177
58 3300044712 Ga0453684_0007358 Ga0453684_0007358_14011_14544 177
59 3300048906 Ga0496103_0308056 Ga0496103_0308056_317_850 177
60 3300049570 Ga0501033_0248577 Ga0501033_0248577_670_1203 177
61 3300049571 Ga0501034_0030653 Ga0501034_0030653_340_873 177
62 3300049823 Ga0501044_0226044 Ga0501044_0226044_101_634 177
63 3300005617 Ga0068859_101299735 Ga0068859_1012997351 178
64 3300005617 Ga0068859_101345063 Ga0068859_1013450632 178
65 3300006931 Ga0097620_101299767 Ga0097620_1012997671 178
66 3300007076 Ga0075435_100923530 Ga0075435_1009235301 178
67 3300009093 Ga0105240_10004550 Ga0105240_100045507 178
68 3300009147 Ga0114129_12121605 Ga0114129_121216051 178
69 3300021441 Ga0213871_10077000 Ga0213871_100770001 178
70 3300025915 Ga0207693_10459357 Ga0207693_104593571 178
71 3300026121 Ga0207683_10718541 Ga0207683_107185411 178
72 3300031548 Ga0307408_100627966 Ga0307408_1006279662 178
73 3300031911 Ga0307412_10080047 Ga0307412_100800472 178
74 3300031995 Ga0307409_100902965 Ga0307409_1009029651 178
75 3300032002 Ga0307416_100071983 Ga0307416_1000719832 178
76 3300039447 Ga0436361_0317879 Ga0436361_0317879_1420_1956 178
77 3300042876 Ga0451577_0010736 Ga0451577_0010736_2265_2837 178
78 3300046461 Ga0495641_0017575 Ga0495641_0017575_1297_1914 178
79 3300050508 nmdc:mga09592_499394_c1 nmdc:mga09592_499394_c1_416_955 178
80 3300005548 Ga0070665_100274010 Ga0070665_1002740102 179
81 3300006028 Ga0070717_10355335 Ga0070717_103553352 179
82 3300009101 Ga0105247_10877773 Ga0105247_108777731 179
83 3300039437 Ga0436365_1120348 Ga0436365_1120348_7284_7823 179
84 3300039438 Ga0436360_0560040 Ga0436360_0560040_1530_2069 179
85 3300039447 Ga0436361_0186997 Ga0436361_0186997_401_940 179
86 3300039447 Ga0436361_0416209 Ga0436361_0416209_25_564 179
87 3300048924 Ga0496121_0084004 Ga0496121_0084004_353_892 179
88 3300005365 Ga0070688_100028779 Ga0070688_1000287793 180
89 3300009093 Ga0105240_10928198 Ga0105240_109281981 180
90 3300041486 Ga0451807_2097684 Ga0451807_2097684_48_590 180
91 3300041512 Ga0451853_0422862 Ga0451853_0422862_92_634 180
92 3300050489 nmdc:mga03683_761_c1 nmdc:mga03683_761_c1_8468_9010 180
93 3300050490 nmdc:mga03n38_23674_c1 nmdc:mga03n38_23674_c1_116_658 180
94 3300050493 nmdc:mga0k408_12003_c1 nmdc:mga0k408_12003_c1_981_1523 180
95 3300050493 nmdc:mga0k408_12577_c1 nmdc:mga0k408_12577_c1_1077_1619 180
96 3300050496 nmdc:mga07m45_1439_c2 nmdc:mga07m45_1439_c2_7667_8209 180
97 3300005295 Ga0065707_10418133 Ga0065707_104181331 181
98 3300005330 Ga0070690_100597513 Ga0070690_1005975132 181
99 3300005347 Ga0070668_100207477 Ga0070668_1002074772 181
100 3300005983 Ga0081540_1010293 Ga0081540_10102932 181
101 3300013306 Ga0163162_10085458 Ga0163162_100854582 181
102 3300017792 Ga0163161_10776288 Ga0163161_107762882 181
103 3300025298 Ga0209050_1001605 Ga0209050_10016059 181
104 3300025933 Ga0207706_10531390 Ga0207706_105313902 181
105 3300025972 Ga0207668_10029396 Ga0207668_100293962 181
106 3300006177 Ga0075362_10000439 Ga0075362_100004393 182
107 3300006353 Ga0075370_10004823 Ga0075370_100048233 182
108 3300050490 nmdc:mga03n38_474919_c1 nmdc:mga03n38_474919_c1_43_591 182
109 3300021361 Ga0213872_10002031 Ga0213872_100020319 183
110 3300021361 Ga0213872_10002976 Ga0213872_100029762 183
111 3300039447 Ga0436361_0251078 Ga0436361_0251078_7543_8094 183
112 3300049569 Ga0501032_0038115 Ga0501032_0038115_1503_2063 186
113 3300003323 rootH1_10064317 rootH1_1006431717 187
114 3300005614 Ga0068856_100000313 Ga0068856_10000031315 187
115 3300009176 Ga0105242_10024721 Ga0105242_100247213 187
116 3300026078 Ga0207702_10001517 Ga0207702_1000151715 187
117 3300037312 Ga0395899_0000022 Ga0395899_0000022_307331_307894 187
118 3300037466 Ga0395898_0000012 Ga0395898_0000012_271241_271804 187
119 3300044694 Ga0466963_0242469 Ga0466963_0242469_479_1042 187
120 3300044842 Ga0466957_0035399 Ga0466957_0035399_423_986 187
121 3300001991 JGI24743J22301_10002380 JGI24743J22301_100023803 188
122 3300002155 JGI24033J26618_1000023 JGI24033J26618_100002311 188
123 3300003320 rootH2_10009508 rootH2_1000950818 188
124 3300003322 rootL2_10099647 rootL2_100996471 188
125 3300005344 Ga0070661_100002798 Ga0070661_1000027986 188
126 3300005355 Ga0070671_100076256 Ga0070671_1000762563 188
127 3300005366 Ga0070659_100015897 Ga0070659_1000158975 188
128 3300005456 Ga0070678_100062666 Ga0070678_1000626662 188
129 3300005543 Ga0070672_100818213 Ga0070672_1008182132 188
130 3300013297 Ga0157378_10016377 Ga0157378_100163775 188
131 3300013297 Ga0157378_10222160 Ga0157378_102221602 188
132 3300025901 Ga0207688_10008111 Ga0207688_100081114 188
133 3300025920 Ga0207649_10002480 Ga0207649_100024802 188
134 3300025931 Ga0207644_10089269 Ga0207644_100892693 188
135 3300025932 Ga0207690_10009770 Ga0207690_100097702 188
136 3300026121 Ga0207683_10086101 Ga0207683_100861012 188
137 3300044683 Ga0466965_0004178 Ga0466965_0004178_4081_4647 188
138 3300044719 Ga0466971_0000040 Ga0466971_0000040_39996_40562 188
139 3300044735 Ga0466968_0091410 Ga0466968_0091410_442_1008 188
140 3300044842 Ga0466957_0011627 Ga0466957_0011627_554_1120 188
141 3300049568 Ga0501031_0000297 Ga0501031_0000297_26032_26607 188
142 3300049569 Ga0501032_0000027 Ga0501032_0000027_18161_18766 188
143 3300049570 Ga0501033_0000002 Ga0501033_0000002_83811_84416 188
144 3300049570 Ga0501033_0000015 Ga0501033_0000015_192797_193363 188
145 3300049573 Ga0501037_0000044 Ga0501037_0000044_80908_81477 188
146 3300049574 Ga0501038_0000020 Ga0501038_0000020_118690_119268 188
147 3300049574 Ga0501038_0002151 Ga0501038_0002151_16831_17397 188
148 3300049574 Ga0501038_0233386 Ga0501038_0233386_297_872 188
149 3300049575 Ga0501039_0008427 Ga0501039_0008427_7051_7626 188
150 3300049579 Ga0501043_0001036 Ga0501043_0001036_13409_13984 188
151 3300049581 Ga0501047_0000900 Ga0501047_0000900_17396_17971 188
152 3300049584 Ga0501068_0549513 Ga0501068_0549513_14_589 188
153 3300049586 Ga0501070_0002044 Ga0501070_0002044_12561_13136 188
154 3300049822 Ga0501035_0000001 Ga0501035_0000001_615352_615927 188
155 3300049823 Ga0501044_0005675 Ga0501044_0005675_8523_9092 188
156 3300049823 Ga0501044_0406426 Ga0501044_0406426_537_1103 188
157 3300061719 Ga0466962_0000003 Ga0466962_0000003_10993_11559 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13482

RNase_H_2

RNase_H superfamily

36

187

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i8a-assembly2.cif.gz_B the crystal structure of the pol2 catalytic domain of dna polymerase epsilon carrying a p301r substitution. 0.7847 1 155
4m8o-assembly1.cif.gz_A ternary complex of dna polymerase epsilon with an incoming datp 0.7771 1 160
8b7e-assembly1.cif.gz_A the crystal structure of n828v variant of dna pol epsilon containing utp in the polymerase active site 0.774 1 161
4i9q-assembly2.cif.gz_B crystal structure of the ternary complex of the d714a mutant of rb69 dna polymerase 0.7638 4 155
6i8a-assembly1.cif.gz_A the crystal structure of the pol2 catalytic domain of dna polymerase epsilon carrying a p301r substitution. 0.7623 1 155
ID Description Score Start End Superfamily
1pdkA02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.835 162 176 2.60.40.10
af_O62244_30_80_2.30.30.360 Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal 0.8343 161 176 2.30.30.360
af_B7ZZ04_152_304_2.100.10.30 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Jacalin-like lectin domain 0.8236 162 177 2.100.10.30
af_I1JTQ5_134_346_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7922 32 47 2.120.10.80
af_A0A2R8RPG4_594_663_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7874 161 178 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A851GEU9-F1-model_v4 Ribonuclease H-like domain-containing protein 0.9879 4 179 GO:0003676
AF-A0A2E5QNG0-F1-model_v4 deleted 0.9875 5 179
AF-A0A3M1BWN7-F1-model_v4 deleted 0.9867 4 76
AF-A0A662E2M7-F1-model_v4 Helicase 0.9864 4 79 GO:0003676
AF-A0A2T6D428-F1-model_v4 Helicase 0.9847 4 181 GO:0003676
GO:0004386

Feature Viewer

pLDDT pTM Quality
92.57 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map