F226384

General Info

Members Datasets Scaffolds Average Seq Length
157 119 314 226

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100001349|Ga0070683_10000134917
Length 235
Sequence MAKIQPGDVISHTEMCLEEMVSLQRGMNFRLRNSSSVILMSLRKGAPYADRVEEDGEVLIYEGHDVPRNLAQIPKAVDQPFYTPKGTLTQNGRFFEAAERFKEGFQKPELVKVYEKIKDGIWVYNGVFELVDAWIEKSDDRNVFKFKLQITDKTIDQKEKRKTELKDLDHNRMIPTSVKLEVWKRDKGRCVQCGRIDNLHFDHILPYSKGGTSLKAENIQLLCARHNLQKRDSII

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
101 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
102 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
103 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
104 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
105 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
106 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
107 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
108 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
109 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
110 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
118 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
119 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 1.27
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 16.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100001349 3300005329 Bacteria 18733
2 JGI24736J21556_1005726 3300001904 Bacteria 2099
3 Ga0070676_10110129 3300005328 Bacteria 1714
4 Ga0070690_100307925 3300005330 Bacteria 1138
5 Ga0070670_100220834 3300005331 Bacteria 1649
6 Ga0068869_100164598 3300005334 Bacteria 1729
7 Ga0068868_100158712 3300005338 Bacteria 1867
8 Ga0070660_100138914 3300005339 Bacteria 1948
9 Ga0070661_100004934 3300005344 Bacteria 9185
10 Ga0070671_100108633 3300005355 Bacteria 2329
11 Ga0070714_100755761 3300005435 Unclassified 940
12 Ga0070711_100004098 3300005439 Bacteria 8566
13 Ga0070708_100218540 3300005445 Unclassified 1787
14 Ga0070706_100119387 3300005467 Unclassified 2457
15 Ga0070706_100204132 3300005467 Bacteria 1846
16 Ga0070707_100015334 3300005468 Bacteria 7190
17 Ga0070698_100632210 3300005471 Bacteria 1011
18 Ga0070684_100005765 3300005535 Bacteria 9522
19 Ga0070697_100392667 3300005536 Bacteria 1203
20 Ga0068853_100008534 3300005539 Bacteria 8236
21 Ga0070665_100101571 3300005548 Bacteria 2880
22 Ga0070665_100365904 3300005548 Unclassified 1448
23 Ga0068855_100057445 3300005563 Bacteria 4561
24 Ga0070664_100003043 3300005564 Bacteria 13556
25 Ga0070664_100134656 3300005564 Bacteria 2172
26 Ga0068857_100001667 3300005577 Bacteria 17833
27 Ga0068857_100377374 3300005577 Bacteria 1316
28 Ga0068852_101088182 3300005616 Bacteria 819
29 Ga0068859_100073041 3300005617 Bacteria 3468
30 Ga0068859_100203711 3300005617 Bacteria 2063
31 Ga0068864_100042929 3300005618 Bacteria 3870
32 Ga0068864_100370228 3300005618 Bacteria 1356
33 Ga0068866_10456864 3300005718 Bacteria 836
34 Ga0068863_100255662 3300005841 Bacteria 1693
35 Ga0068863_100487878 3300005841 Bacteria 1212
36 Ga0068858_100689487 3300005842 Unclassified 994
37 Ga0068860_100486203 3300005843 Bacteria 1231
38 Ga0070712_100001418 3300006175 Bacteria 14581
39 Ga0075429_100040693 3300006880 Bacteria 4047
40 Ga0068865_100125966 3300006881 Bacteria 1912
41 Ga0097620_100073044 3300006931 Bacteria 3468
42 Ga0097620_100203726 3300006931 Bacteria 2063
43 Ga0075435_100405431 3300007076 Unclassified 1173
44 Ga0105240_10012674 3300009093 Bacteria 11619
45 Ga0105240_10655184 3300009093 Bacteria 1150
46 Ga0105240_10833490 3300009093 Unclassified 997
47 Ga0105240_11191801 3300009093 Unclassified 807
48 Ga0105245_10092457 3300009098 Bacteria 2786
49 Ga0105248_10290277 3300009177 Bacteria 1842
50 Ga0105237_11126807 3300009545 Bacteria 791
51 Ga0105238_10757944 3300009551 Unclassified 985
52 Ga0105249_10077419 3300009553 Unclassified 3084
53 Ga0105249_10228379 3300009553 Bacteria 1835
54 Ga0105249_10255176 3300009553 Bacteria 1740
55 Ga0105249_11519520 3300009553 Unclassified 742
56 Ga0157371_10303963 3300013102 Unclassified 1155
57 Ga0157370_10008987 3300013104 Bacteria 10726
58 Ga0157370_10207796 3300013104 Bacteria 1815
59 Ga0157370_10978916 3300013104 Unclassified 766
60 Ga0157369_11289153 3300013105 Unclassified 745
61 Ga0157374_10012074 3300013296 Bacteria 7501
62 Ga0157374_10472884 3300013296 Bacteria 1256
63 Ga0157374_11091594 3300013296 Unclassified 818
64 Ga0157374_11377831 3300013296 Bacteria 728
65 Ga0157378_10035015 3300013297 Bacteria 4440
66 Ga0163162_10044628 3300013306 Bacteria 4440
67 Ga0163162_10086421 3300013306 Bacteria 3214
68 Ga0163162_10206492 3300013306 Bacteria 2094
69 Ga0157372_10141048 3300013307 Bacteria 2776
70 Ga0157372_10546724 3300013307 Bacteria 1350
71 Ga0157375_10129390 3300013308 Bacteria 2643
72 Ga0157375_10254311 3300013308 Bacteria 1918
73 Ga0157375_10308530 3300013308 Unclassified 1746
74 Ga0157375_11363192 3300013308 Unclassified 835
75 Ga0163163_10066883 3300014325 Bacteria 3571
76 Ga0163163_10600931 3300014325 Bacteria 1163
77 Ga0157380_10250824 3300014326 Bacteria 1602
78 Ga0157380_10701814 3300014326 Unclassified 1017
79 Ga0157379_10351020 3300014968 Bacteria 1350
80 Ga0157376_10071023 3300014969 Bacteria 2957
81 Ga0157376_10164079 3300014969 Bacteria 2017
82 Ga0157376_10191376 3300014969 Bacteria 1876
83 Ga0207647_10048469 3300025904 Bacteria 2638
84 Ga0207684_10037049 3300025910 Bacteria 4140
85 Ga0207695_10306578 3300025913 Bacteria 1478
86 Ga0207695_10465906 3300025913 Bacteria 1146
87 Ga0207693_10002974 3300025915 Bacteria 14679
88 Ga0207663_10011153 3300025916 Unclassified 4815
89 Ga0207646_10087023 3300025922 Bacteria 2796
90 Ga0207694_10540115 3300025924 Bacteria 978
91 Ga0207687_10036396 3300025927 Bacteria 3353
92 Ga0207644_10079605 3300025931 Bacteria 2418
93 Ga0207691_10420325 3300025940 Bacteria 1139
94 Ga0207661_10010339 3300025944 Bacteria 6714
95 Ga0207679_10000698 3300025945 Bacteria 22446
96 Ga0207679_10002691 3300025945 Bacteria 10978
97 Ga0207667_10025220 3300025949 Bacteria 6511
98 Ga0207651_10774874 3300025960 Bacteria 849
99 Ga0207712_10107725 3300025961 Unclassified 2084
100 Ga0207640_10402659 3300025981 Bacteria 1115
101 Ga0207677_10505899 3300026023 Bacteria 1045
102 Ga0207639_10014910 3300026041 Bacteria 5475
103 Ga0207641_10179908 3300026088 Bacteria 1936
104 Ga0207641_10354056 3300026088 Bacteria 1400
105 Ga0207676_10324596 3300026095 Bacteria 1414
106 Ga0207674_10004034 3300026116 Bacteria 17814
107 Ga0207674_10932666 3300026116 Bacteria 836
108 Ga0268266_10003500 3300028379 Bacteria 15611
109 Ga0268266_10075406 3300028379 Bacteria 2930
110 Ga0265338_10029430 3300028800 Bacteria 5445
111 Ga0265327_10042394 3300031251 Bacteria 2443
112 Ga0265316_10001774 3300031344 Bacteria 22770
113 Ga0265316_10161588 3300031344 Bacteria 1674
114 Ga0265342_10107771 3300031712 Bacteria 1580
115 Ga0307405_10277341 3300031731 Unclassified 1260
116 Ga0307412_10076164 3300031911 Unclassified 2304
117 Ga0373947_0029833 3300035725 Unclassified 3202
118 Ga0373925_0024949 3300037068 Unclassified 4366
119 Ga0436361_0220545 3300039447 Bacteria 3280
120 Ga0451577_0606206 3300042876 Bacteria 994
121 Ga0453684_0000010 3300044712 Bacteria 1133422
122 Ga0495580_0000609 3300046472 Bacteria 30239
123 Ga0495580_0018759 3300046472 Bacteria 5148
124 Ga0495582_0016978 3300046473 Bacteria 3986
125 Ga0495647_0063362 3300046681 Bacteria 1464
126 Ga0495669_0026987 3300046684 Bacteria 2511
127 Ga0495604_0383736 3300047317 Unclassified 928
128 Ga0495672_0000255 3300047320 Bacteria 74469
129 Ga0495672_0010371 3300047320 Bacteria 6646
130 Ga0495686_0058247 3300047472 Bacteria 2408
131 Ga0496104_0290286 3300048907 Bacteria 1548
132 Ga0496114_0570350 3300048917 Unclassified 999
133 Ga0496126_0001149 3300048929 Bacteria 43907
134 Ga0501033_0051392 3300049570 Bacteria 3055
135 Ga0501034_0074108 3300049571 Bacteria 3412
136 Ga0501037_0079414 3300049573 Bacteria 2381
137 Ga0501202_004952 3300049652 Bacteria 2346
138 Ga0501206_004055 3300049653 Bacteria 1863
139 Ga0501207_003648 3300049654 Bacteria 2061
140 Ga0501216_083009 3300049660 Bacteria 681
141 Ga0501217_001131 3300049661 Bacteria 4876
142 Ga0501223_001148 3300049663 Bacteria 6233
143 Ga0501223_001776 3300049663 Bacteria 4885
144 Ga0501224_004616 3300049664 Bacteria 1960
145 Ga0501235_002451 3300049669 Bacteria 4001
146 Ga0501243_005143 3300049675 Bacteria 1965
147 Ga0501259_001985 3300049688 Bacteria 3381
148 Ga0501261_002386 3300049690 Bacteria 2304
149 Ga0501080_0039632 3300049742 Bacteria 4397
150 Ga0501226_008477 3300049853 Bacteria 1148
151 nmdc:mga09592_20220_c1 3300050508 Bacteria 5470
152 nmdc:mga08y16_796499_c1 3300050511 Bacteria 938
153 nmdc:mga0n895_36390_c1 3300050512 Bacteria 4753
154 nmdc:mga0rr50_283780_c1 3300050513 Bacteria 1382
155 Ga0500595_000027 3300053119 Bacteria 130868
156 Ga0500637_0003602 3300053178 Bacteria 7193
157 Ga0500645_080963 3300053730 Bacteria 927
158 Ga0070683_100001349
159 JGI24736J21556_1005726
160 Ga0070676_10110129
161 Ga0070690_100307925
162 Ga0070670_100220834
163 Ga0068869_100164598
164 Ga0068868_100158712
165 Ga0070660_100138914
166 Ga0070661_100004934
167 Ga0070671_100108633
168 Ga0070714_100755761
169 Ga0070711_100004098
170 Ga0070708_100218540
171 Ga0070706_100119387
172 Ga0070706_100204132
173 Ga0070707_100015334
174 Ga0070698_100632210
175 Ga0070684_100005765
176 Ga0070697_100392667
177 Ga0068853_100008534
178 Ga0070665_100101571
179 Ga0070665_100365904
180 Ga0068855_100057445
181 Ga0070664_100003043
182 Ga0070664_100134656
183 Ga0068857_100001667
184 Ga0068857_100377374
185 Ga0068852_101088182
186 Ga0068859_100073041
187 Ga0068859_100203711
188 Ga0068864_100042929
189 Ga0068864_100370228
190 Ga0068866_10456864
191 Ga0068863_100255662
192 Ga0068863_100487878
193 Ga0068858_100689487
194 Ga0068860_100486203
195 Ga0070712_100001418
196 Ga0075429_100040693
197 Ga0068865_100125966
198 Ga0097620_100073044
199 Ga0097620_100203726
200 Ga0075435_100405431
201 Ga0105240_10012674
202 Ga0105240_10655184
203 Ga0105240_10833490
204 Ga0105240_11191801
205 Ga0105245_10092457
206 Ga0105248_10290277
207 Ga0105237_11126807
208 Ga0105238_10757944
209 Ga0105249_10077419
210 Ga0105249_10228379
211 Ga0105249_10255176
212 Ga0105249_11519520
213 Ga0157371_10303963
214 Ga0157370_10008987
215 Ga0157370_10207796
216 Ga0157370_10978916
217 Ga0157369_11289153
218 Ga0157374_10012074
219 Ga0157374_10472884
220 Ga0157374_11091594
221 Ga0157374_11377831
222 Ga0157378_10035015
223 Ga0163162_10044628
224 Ga0163162_10086421
225 Ga0163162_10206492
226 Ga0157372_10141048
227 Ga0157372_10546724
228 Ga0157375_10129390
229 Ga0157375_10254311
230 Ga0157375_10308530
231 Ga0157375_11363192
232 Ga0163163_10066883
233 Ga0163163_10600931
234 Ga0157380_10250824
235 Ga0157380_10701814
236 Ga0157379_10351020
237 Ga0157376_10071023
238 Ga0157376_10164079
239 Ga0157376_10191376
240 Ga0207647_10048469
241 Ga0207684_10037049
242 Ga0207695_10306578
243 Ga0207695_10465906
244 Ga0207693_10002974
245 Ga0207663_10011153
246 Ga0207646_10087023
247 Ga0207694_10540115
248 Ga0207687_10036396
249 Ga0207644_10079605
250 Ga0207691_10420325
251 Ga0207661_10010339
252 Ga0207679_10000698
253 Ga0207679_10002691
254 Ga0207667_10025220
255 Ga0207651_10774874
256 Ga0207712_10107725
257 Ga0207640_10402659
258 Ga0207677_10505899
259 Ga0207639_10014910
260 Ga0207641_10179908
261 Ga0207641_10354056
262 Ga0207676_10324596
263 Ga0207674_10004034
264 Ga0207674_10932666
265 Ga0268266_10003500
266 Ga0268266_10075406
267 Ga0265338_10029430
268 Ga0265327_10042394
269 Ga0265316_10001774
270 Ga0265316_10161588
271 Ga0265342_10107771
272 Ga0307405_10277341
273 Ga0307412_10076164
274 Ga0373947_0029833
275 Ga0373925_0024949
276 Ga0436361_0220545
277 Ga0451577_0606206
278 Ga0453684_0000010
279 Ga0495580_0000609
280 Ga0495580_0018759
281 Ga0495582_0016978
282 Ga0495647_0063362
283 Ga0495669_0026987
284 Ga0495604_0383736
285 Ga0495672_0000255
286 Ga0495672_0010371
287 Ga0495686_0058247
288 Ga0496104_0290286
289 Ga0496114_0570350
290 Ga0496126_0001149
291 Ga0501033_0051392
292 Ga0501034_0074108
293 Ga0501037_0079414
294 Ga0501202_004952
295 Ga0501206_004055
296 Ga0501207_003648
297 Ga0501216_083009
298 Ga0501217_001131
299 Ga0501223_001148
300 Ga0501223_001776
301 Ga0501224_004616
302 Ga0501235_002451
303 Ga0501243_005143
304 Ga0501259_001985
305 Ga0501261_002386
306 Ga0501080_0039632
307 Ga0501226_008477
308 nmdc:mga09592_20220_c1
309 nmdc:mga08y16_796499_c1
310 nmdc:mga0n895_36390_c1
311 nmdc:mga0rr50_283780_c1
312 Ga0500595_000027
313 Ga0500637_0003602
314 Ga0500645_080963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01844

HNH

HNH endonuclease

190

233

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vlp-assembly1.cif.gz_B r54a mutant of e9 dnase domain in complex with im9 0.8686 197 230
2vlq-assembly1.cif.gz_B f86a mutant of e9 dnase domain in complex with im9 0.8594 197 230
2vln-assembly1.cif.gz_B n75a mutant of e9 dnase domain in complex with im9 0.8587 197 230
8fef-assembly1.cif.gz_A structure of mce1 transporter from mycobacterium smegmatis (map0) 0.7728 126 148
3q0d-assembly1.cif.gz_X crystal structure of suvh5 sra- hemi methylated cg dna complex 0.7699 1 150
ID Description Score Start End Superfamily
af_P71806_355_434_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.772 170 232 2.30.29.30
5fuyE02 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1; 0.7146 187 230 3.30.60.20
af_Q6F322_199_378_2.30.280.10 Mainly Beta;Roll;PUA domain-like;SRA-YDG 0.6888 1 151 2.30.280.10
af_Q9FHI0_159_328_2.30.280.10 Mainly Beta;Roll;PUA domain-like;SRA-YDG 0.6888 1 151 2.30.280.10
4uxiB02 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1; 0.6837 187 224 3.30.60.20
ID Description Score Start End GO Terms
AF-A0A0F9P3A2-F1-model_v4 HNH nuclease domain-containing protein 0.9439 170 232 GO:0003676
GO:0004519
GO:0008270
AF-A0A2E6UID0-F1-model_v4 deleted 0.943 167 233
AF-A0A6P1D139-F1-model_v4 HNH endonuclease 0.9327 168 232 GO:0003676
GO:0004519
GO:0008270
AF-A0A662RAZ1-F1-model_v4 HNH endonuclease 0.9312 1 150 GO:0004519
AF-A0A6J4LVC0-F1-model_v4 HNH nuclease domain-containing protein 0.9283 170 233 GO:0003676
GO:0004519
GO:0008270

Map