F220710

General Info

Members Datasets Scaffolds Average Seq Length
154 112 154 134

Family's Representative Sequence

Representative Sequence 3300049665|Ga0501227_190970|Ga0501227_190970_146_538
Length 130
Sequence MPTVTRLLHTRYRVNDLAASVKFYTECLGLTVSRQHTSPRGAQLVFLSTPNSTEEIELCQMPAGAAEPVKVQSDLTHLAFEVESLEKFAAEAAAKGYKLSDGPTKTGSGSVIAFIDAPEGYEVELIQRAK

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
107 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
108 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10411405 3300005288 Bacteria 582
2 Ga0065707_10182064 3300005295 Bacteria 1412
3 Ga0070658_10164284 3300005327 Unclassified 1864
4 Ga0070683_101194180 3300005329 Unclassified 731
5 Ga0070690_100408734 3300005330 Unclassified 998
6 Ga0070690_101720289 3300005330 Bacteria 510
7 Ga0068869_100602251 3300005334 Bacteria 928
8 Ga0070689_100005151 3300005340 Bacteria 8893
9 Ga0070687_101020216 3300005343 Unclassified 601
10 Ga0070675_100712813 3300005354 Bacteria 914
11 Ga0070675_101228250 3300005354 Unclassified 690
12 Ga0070673_102317255 3300005364 Unclassified 510
13 Ga0070688_100013215 3300005365 Bacteria 4651
14 Ga0070688_100972023 3300005365 Unclassified 673
15 Ga0070688_101163926 3300005365 Unclassified 618
16 Ga0070713_100512151 3300005436 Bacteria 1133
17 Ga0070710_10698479 3300005437 Bacteria 716
18 Ga0070701_10976781 3300005438 Unclassified 589
19 Ga0070711_100584104 3300005439 Bacteria 930
20 Ga0070705_100937195 3300005440 Unclassified 699
21 Ga0070694_100953939 3300005444 Bacteria 710
22 Ga0070685_10016478 3300005466 Bacteria 3938
23 Ga0070685_10061893 3300005466 Bacteria 2193
24 Ga0070685_11491660 3300005466 Unclassified 521
25 Ga0070697_100564762 3300005536 Bacteria 998
26 Ga0070686_100273305 3300005544 Unclassified 1243
27 Ga0070693_101363344 3300005547 Bacteria 550
28 Ga0070704_100597017 3300005549 Unclassified 970
29 Ga0068857_100717539 3300005577 Unclassified 951
30 Ga0068852_100843595 3300005616 Bacteria 932
31 Ga0068859_100583358 3300005617 Bacteria 1212
32 Ga0068859_102431220 3300005617 Unclassified 577
33 Ga0068864_100045202 3300005618 Bacteria 3777
34 Ga0068851_10227460 3300005834 Bacteria 1050
35 Ga0068858_101051147 3300005842 Bacteria 799
36 Ga0068860_100104534 3300005843 Unclassified 2704
37 Ga0068862_100699195 3300005844 Bacteria 982
38 Ga0070715_10227191 3300006163 Unclassified 963
39 Ga0070712_100120626 3300006175 Bacteria 1972
40 Ga0070712_100576494 3300006175 Unclassified 950
41 Ga0097621_100871385 3300006237 Bacteria 837
42 Ga0097621_101028655 3300006237 Unclassified 771
43 Ga0075428_100180139 3300006844 Unclassified 2288
44 Ga0075428_100488396 3300006844 Unclassified 1318
45 Ga0075429_100122816 3300006880 Bacteria 2270
46 Ga0068865_100604449 3300006881 Bacteria 927
47 Ga0075436_100068221 3300006914 Bacteria 2457
48 Ga0075436_100439156 3300006914 Bacteria 949
49 Ga0097620_100583363 3300006931 Bacteria 1212
50 Ga0097620_102431819 3300006931 Unclassified 577
51 Ga0075435_100064218 3300007076 Bacteria 2982
52 Ga0099795_10023664 3300007788 Bacteria 2040
53 Ga0105240_10034290 3300009093 Bacteria 6548
54 Ga0105240_10085803 3300009093 Bacteria 3857
55 Ga0111539_10147783 3300009094 Bacteria 2752
56 Ga0111539_10578941 3300009094 Unclassified 1307
57 Ga0111539_10716768 3300009094 Bacteria 1164
58 Ga0111539_11151472 3300009094 Bacteria 901
59 Ga0105245_10067006 3300009098 Bacteria 3251
60 Ga0105247_10518918 3300009101 Bacteria 871
61 Ga0105241_11054324 3300009174 Unclassified 763
62 Ga0105242_10064426 3300009176 Unclassified 3021
63 Ga0105248_10335176 3300009177 Bacteria 1703
64 Ga0105248_11175639 3300009177 Bacteria 867
65 Ga0105238_11276694 3300009551 Bacteria 760
66 Ga0105249_11525723 3300009553 Unclassified 740
67 Ga0105239_11361752 3300010375 Bacteria 819
68 Ga0105239_11851209 3300010375 Unclassified 700
69 Ga0157374_10147438 3300013296 Bacteria 2286
70 Ga0157374_12028860 3300013296 Unclassified 602
71 Ga0157378_10105359 3300013297 Bacteria 2578
72 Ga0163162_11606748 3300013306 Bacteria 742
73 Ga0157375_10099764 3300013308 Bacteria 2983
74 Ga0163163_10319744 3300014325 Bacteria 1606
75 Ga0157380_13294086 3300014326 Unclassified 516
76 Ga0157379_11755971 3300014968 Unclassified 609
77 Ga0157376_10298145 3300014969 Bacteria 1525
78 Ga0157376_12785292 3300014969 Unclassified 529
79 Ga0157376_12894872 3300014969 Bacteria 519
80 Ga0207692_10670033 3300025898 Bacteria 671
81 Ga0207695_10751816 3300025913 Bacteria 855
82 Ga0207693_10165848 3300025915 Bacteria 1739
83 Ga0207694_10042118 3300025924 Bacteria 3521
84 Ga0207694_10875471 3300025924 Bacteria 759
85 Ga0207659_11152578 3300025926 Unclassified 667
86 Ga0207670_10003025 3300025936 Bacteria 8875
87 Ga0207711_10678589 3300025941 Bacteria 961
88 Ga0207661_11185800 3300025944 Unclassified 703
89 Ga0207641_10434447 3300026088 Bacteria 1266
90 Ga0207674_10368553 3300026116 Unclassified 1388
91 Ga0207675_100264248 3300026118 Unclassified 1668
92 Ga0268265_10945855 3300028380 Unclassified 848
93 Ga0265337_1000045 3300028556 Bacteria 54551
94 Ga0265337_1017322 3300028556 Bacteria 2311
95 Ga0265337_1023374 3300028556 Bacteria 1902
96 Ga0265326_10003243 3300028558 Bacteria 5358
97 Ga0265326_10120221 3300028558 Unclassified 747
98 Ga0265326_10137528 3300028558 Unclassified 697
99 Ga0265322_10176326 3300028654 Unclassified 612
100 Ga0265336_10002149 3300028666 Bacteria 8331
101 Ga0265336_10013637 3300028666 Bacteria 2707
102 Ga0265338_10017114 3300028800 Bacteria 7834
103 Ga0265338_10119751 3300028800 Bacteria 2101
104 Ga0265338_10766386 3300028800 Unclassified 663
105 Ga0265330_10279302 3300031235 Unclassified 704
106 Ga0265320_10069544 3300031240 Bacteria 1662
107 Ga0373932_0406416 3300035112 Unclassified 528
108 Ga0373931_0800449 3300035691 Unclassified 628
109 Ga0373933_0659669 3300035724 Bacteria 688
110 Ga0373937_0583773 3300036401 Bacteria 1061
111 Ga0373937_0954577 3300036401 Bacteria 806
112 Ga0373925_1571064 3300037068 Bacteria 538
113 Ga0450916_059289 3300042530 Unclassified 619
114 Ga0453684_0002551 3300044712 Bacteria 43788
115 Ga0451576_0038087 3300045051 Bacteria 5090
116 Ga0451576_0803316 3300045051 Unclassified 988
117 Ga0451576_1075488 3300045051 Unclassified 842
118 Ga0495603_0525534 3300046455 Unclassified 678
119 Ga0495651_0226881 3300046462 Bacteria 1289
120 Ga0495639_0062591 3300046475 Bacteria 1707
121 Ga0495662_0053957 3300046476 Bacteria 1942
122 Ga0495594_0336482 3300046499 Bacteria 860
123 Ga0495618_0008949 3300046514 Bacteria 6042
124 Ga0495628_0001479 3300046516 Bacteria 21522
125 Ga0495630_0002062 3300046517 Bacteria 13974
126 Ga0495630_0257221 3300046517 Unclassified 1334
127 Ga0495630_0533633 3300046517 Bacteria 900
128 Ga0495666_0013509 3300046526 Bacteria 4070
129 Ga0495640_0257137 3300046533 Bacteria 1092
130 Ga0495586_0000922 3300046535 Bacteria 16741
131 Ga0495586_0000924 3300046535 Bacteria 16690
132 Ga0495645_0061434 3300046543 Bacteria 2722
133 Ga0495645_0099338 3300046543 Unclassified 2071
134 Ga0495645_0877340 3300046543 Unclassified 534
135 Ga0495634_0020948 3300046642 Bacteria 4631
136 Ga0495634_0533087 3300046642 Unclassified 686
137 Ga0495599_0035646 3300046678 Bacteria 3124
138 Ga0495647_0034906 3300046681 Unclassified 1886
139 Ga0495658_0006564 3300046683 Bacteria 5714
140 Ga0495658_0007300 3300046683 Bacteria 5461
141 Ga0495613_0005764 3300046689 Bacteria 9274
142 Ga0495674_0111175 3300047319 Bacteria 2322
143 Ga0495676_0137275 3300047321 Unclassified 1757
144 Ga0495684_1003947 3300047471 Bacteria 530
145 Ga0495614_0136565 3300048089 Bacteria 1088
146 Ga0501227_190970 3300049665 Bacteria 578
147 Ga0501283_014515 3300049779 Bacteria 1204
148 nmdc:mga09592_100400_c1 3300050508 Unclassified 2478
149 nmdc:mga08y16_1435880_c1 3300050511 Bacteria 652
150 nmdc:mga08y16_182082_c1 3300050511 Unclassified 2181
151 nmdc:mga08y16_560922_c1 3300050511 Bacteria 1155
152 nmdc:mga0rr50_440442_c1 3300050513 Bacteria 1104
153 nmdc:mga08x19_165842_c1 3300050514 Bacteria 1502
154 nmdc:mga08x19_528262_c1 3300050514 Bacteria 834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025926 Ga0207659_11152578 Ga0207659_111525782 123
2 3300005437 Ga0070710_10698479 Ga0070710_106984792 125
3 3300014968 Ga0157379_11755971 Ga0157379_117559711 125
4 3300025898 Ga0207692_10670033 Ga0207692_106700332 125
5 3300005329 Ga0070683_101194180 Ga0070683_1011941801 126
6 3300005617 Ga0068859_100583358 Ga0068859_1005833581 126
7 3300006931 Ga0097620_100583363 Ga0097620_1005833631 126
8 3300009094 Ga0111539_10578941 Ga0111539_105789411 126
9 3300009553 Ga0105249_11525723 Ga0105249_115257231 126
10 3300013296 Ga0157374_10147438 Ga0157374_101474383 126
11 3300026118 Ga0207675_100264248 Ga0207675_1002642481 126
12 3300005327 Ga0070658_10164284 Ga0070658_101642842 127
13 3300005547 Ga0070693_101363344 Ga0070693_1013633441 127
14 3300005617 Ga0068859_102431220 Ga0068859_1024312201 127
15 3300006931 Ga0097620_102431819 Ga0097620_1024318191 127
16 3300009094 Ga0111539_11151472 Ga0111539_111514721 127
17 3300009174 Ga0105241_11054324 Ga0105241_110543241 127
18 3300009177 Ga0105248_11175639 Ga0105248_111756392 127
19 3300013306 Ga0163162_11606748 Ga0163162_116067481 127
20 3300014969 Ga0157376_12785292 Ga0157376_127852921 127
21 3300049665 Ga0501227_190970 Ga0501227_190970_146_538 127
22 3300049779 Ga0501283_014515 Ga0501283_014515_33_467 127
23 3300050511 nmdc:mga08y16_1435880_c1 nmdc:mga08y16_1435880_c1_130_516 127
24 3300005330 Ga0070690_101720289 Ga0070690_1017202891 128
25 3300005334 Ga0068869_100602251 Ga0068869_1006022511 128
26 3300006237 Ga0097621_100871385 Ga0097621_1008713852 128
27 3300006237 Ga0097621_101028655 Ga0097621_1010286551 128
28 3300009177 Ga0105248_10335176 Ga0105248_103351762 128
29 3300013296 Ga0157374_12028860 Ga0157374_120288601 128
30 3300013308 Ga0157375_10099764 Ga0157375_100997642 128
31 3300014969 Ga0157376_10298145 Ga0157376_102981452 128
32 3300025941 Ga0207711_10678589 Ga0207711_106785892 128
33 3300025944 Ga0207661_11185800 Ga0207661_111858001 128
34 3300028558 Ga0265326_10003243 Ga0265326_100032436 128
35 3300028800 Ga0265338_10119751 Ga0265338_101197511 128
36 3300046499 Ga0495594_0336482 Ga0495594_0336482_378_770 128
37 3300046543 Ga0495645_0877340 Ga0495645_0877340_134_523 128
38 3300028556 Ga0265337_1000045 Ga0265337_100004532 129
39 3300028558 Ga0265326_10120221 Ga0265326_101202211 129
40 3300028666 Ga0265336_10013637 Ga0265336_100136373 129
41 3300037068 Ga0373925_1571064 Ga0373925_1571064_110_505 129
42 3300047471 Ga0495684_1003947 Ga0495684_1003947_67_462 129
43 3300005616 Ga0068852_100843595 Ga0068852_1008435951 130
44 3300009093 Ga0105240_10034290 Ga0105240_100342905 130
45 3300025913 Ga0207695_10751816 Ga0207695_107518161 130
46 3300028556 Ga0265337_1017322 Ga0265337_10173221 130
47 3300028556 Ga0265337_1023374 Ga0265337_10233742 130
48 3300028558 Ga0265326_10137528 Ga0265326_101375281 130
49 3300028666 Ga0265336_10002149 Ga0265336_100021493 130
50 3300028800 Ga0265338_10017114 Ga0265338_100171147 130
51 3300028800 Ga0265338_10766386 Ga0265338_107663862 130
52 3300031235 Ga0265330_10279302 Ga0265330_102793021 130
53 3300031240 Ga0265320_10069544 Ga0265320_100695443 130
54 3300036401 Ga0373937_0954577 Ga0373937_0954577_240_635 130
55 3300005577 Ga0068857_100717539 Ga0068857_1007175392 131
56 3300006914 Ga0075436_100068221 Ga0075436_1000682212 131
57 3300009551 Ga0105238_11276694 Ga0105238_112766941 131
58 3300025924 Ga0207694_10042118 Ga0207694_100421182 131
59 3300025924 Ga0207694_10875471 Ga0207694_108754711 131
60 3300028654 Ga0265322_10176326 Ga0265322_101763261 131
61 3300046476 Ga0495662_0053957 Ga0495662_0053957_80_478 131
62 3300046514 Ga0495618_0008949 Ga0495618_0008949_568_966 131
63 3300046516 Ga0495628_0001479 Ga0495628_0001479_19529_19927 131
64 3300046517 Ga0495630_0002062 Ga0495630_0002062_1970_2368 131
65 3300046526 Ga0495666_0013509 Ga0495666_0013509_777_1175 131
66 3300046535 Ga0495586_0000922 Ga0495586_0000922_7150_7548 131
67 3300046543 Ga0495645_0061434 Ga0495645_0061434_778_1176 131
68 3300046678 Ga0495599_0035646 Ga0495599_0035646_1017_1415 131
69 3300047319 Ga0495674_0111175 Ga0495674_0111175_1368_1766 131
70 3300048089 Ga0495614_0136565 Ga0495614_0136565_86_484 131
71 3300050514 nmdc:mga08x19_165842_c1 nmdc:mga08x19_165842_c1_231_629 131
72 3300005330 Ga0070690_100408734 Ga0070690_1004087342 132
73 3300005354 Ga0070675_100712813 Ga0070675_1007128132 132
74 3300005364 Ga0070673_102317255 Ga0070673_1023172551 132
75 3300005436 Ga0070713_100512151 Ga0070713_1005121512 132
76 3300005439 Ga0070711_100584104 Ga0070711_1005841042 132
77 3300005440 Ga0070705_100937195 Ga0070705_1009371951 132
78 3300005444 Ga0070694_100953939 Ga0070694_1009539391 132
79 3300005536 Ga0070697_100564762 Ga0070697_1005647622 132
80 3300005544 Ga0070686_100273305 Ga0070686_1002733052 132
81 3300005549 Ga0070704_100597017 Ga0070704_1005970172 132
82 3300005618 Ga0068864_100045202 Ga0068864_1000452023 132
83 3300005842 Ga0068858_101051147 Ga0068858_1010511472 132
84 3300005843 Ga0068860_100104534 Ga0068860_1001045342 132
85 3300005844 Ga0068862_100699195 Ga0068862_1006991951 132
86 3300006163 Ga0070715_10227191 Ga0070715_102271912 132
87 3300006175 Ga0070712_100120626 Ga0070712_1001206262 132
88 3300006175 Ga0070712_100576494 Ga0070712_1005764941 132
89 3300006844 Ga0075428_100180139 Ga0075428_1001801392 132
90 3300006881 Ga0068865_100604449 Ga0068865_1006044491 132
91 3300006914 Ga0075436_100439156 Ga0075436_1004391561 132
92 3300007076 Ga0075435_100064218 Ga0075435_1000642184 132
93 3300007788 Ga0099795_10023664 Ga0099795_100236643 132
94 3300009093 Ga0105240_10085803 Ga0105240_100858031 132
95 3300009098 Ga0105245_10067006 Ga0105245_100670062 132
96 3300009101 Ga0105247_10518918 Ga0105247_105189182 132
97 3300009176 Ga0105242_10064426 Ga0105242_100644262 132
98 3300010375 Ga0105239_11361752 Ga0105239_113617522 132
99 3300010375 Ga0105239_11851209 Ga0105239_118512091 132
100 3300014325 Ga0163163_10319744 Ga0163163_103197441 132
101 3300014326 Ga0157380_13294086 Ga0157380_132940861 132
102 3300014969 Ga0157376_12894872 Ga0157376_128948721 132
103 3300025915 Ga0207693_10165848 Ga0207693_101658482 132
104 3300026088 Ga0207641_10434447 Ga0207641_104344472 132
105 3300035112 Ga0373932_0406416 Ga0373932_0406416_52_453 132
106 3300035691 Ga0373931_0800449 Ga0373931_0800449_177_578 132
107 3300035724 Ga0373933_0659669 Ga0373933_0659669_22_423 132
108 3300036401 Ga0373937_0583773 Ga0373937_0583773_421_822 132
109 3300044712 Ga0453684_0002551 Ga0453684_0002551_33750_34151 132
110 3300045051 Ga0451576_0038087 Ga0451576_0038087_909_1310 132
111 3300045051 Ga0451576_0803316 Ga0451576_0803316_149_589 132
112 3300046455 Ga0495603_0525534 Ga0495603_0525534_69_548 132
113 3300046462 Ga0495651_0226881 Ga0495651_0226881_590_1045 132
114 3300046475 Ga0495639_0062591 Ga0495639_0062591_742_1221 132
115 3300046517 Ga0495630_0257221 Ga0495630_0257221_221_700 132
116 3300046533 Ga0495640_0257137 Ga0495640_0257137_577_1056 132
117 3300046535 Ga0495586_0000924 Ga0495586_0000924_9138_9617 132
118 3300046543 Ga0495645_0099338 Ga0495645_0099338_25_426 132
119 3300046642 Ga0495634_0020948 Ga0495634_0020948_4100_4579 132
120 3300046642 Ga0495634_0533087 Ga0495634_0533087_262_663 132
121 3300046681 Ga0495647_0034906 Ga0495647_0034906_285_764 132
122 3300046683 Ga0495658_0007300 Ga0495658_0007300_928_1407 132
123 3300046689 Ga0495613_0005764 Ga0495613_0005764_1973_2452 132
124 3300047321 Ga0495676_0137275 Ga0495676_0137275_552_1031 132
125 3300050513 nmdc:mga0rr50_440442_c1 nmdc:mga0rr50_440442_c1_172_570 132
126 3300050514 nmdc:mga08x19_528262_c1 nmdc:mga08x19_528262_c1_367_768 132
127 3300005343 Ga0070687_101020216 Ga0070687_1010202161 133
128 3300005365 Ga0070688_100972023 Ga0070688_1009720231 133
129 3300005438 Ga0070701_10976781 Ga0070701_109767811 133
130 3300005466 Ga0070685_10061893 Ga0070685_100618934 133
131 3300005834 Ga0068851_10227460 Ga0068851_102274602 133
132 3300013297 Ga0157378_10105359 Ga0157378_101053592 133
133 3300005288 Ga0065714_10411405 Ga0065714_104114051 134
134 3300005295 Ga0065707_10182064 Ga0065707_101820642 134
135 3300005340 Ga0070689_100005151 Ga0070689_1000051516 134
136 3300005354 Ga0070675_101228250 Ga0070675_1012282501 134
137 3300005365 Ga0070688_100013215 Ga0070688_1000132152 134
138 3300005365 Ga0070688_101163926 Ga0070688_1011639261 134
139 3300005466 Ga0070685_10016478 Ga0070685_100164782 134
140 3300005466 Ga0070685_11491660 Ga0070685_114916601 134
141 3300006844 Ga0075428_100488396 Ga0075428_1004883962 134
142 3300006880 Ga0075429_100122816 Ga0075429_1001228162 134
143 3300009094 Ga0111539_10147783 Ga0111539_101477832 134
144 3300009094 Ga0111539_10716768 Ga0111539_107167682 134
145 3300025936 Ga0207670_10003025 Ga0207670_100030256 134
146 3300026116 Ga0207674_10368553 Ga0207674_103685531 134
147 3300028380 Ga0268265_10945855 Ga0268265_109458551 134
148 3300042530 Ga0450916_059289 Ga0450916_059289_144_551 134
149 3300045051 Ga0451576_1075488 Ga0451576_1075488_275_685 134
150 3300046517 Ga0495630_0533633 Ga0495630_0533633_465_869 134
151 3300046683 Ga0495658_0006564 Ga0495658_0006564_947_1351 134
152 3300050508 nmdc:mga09592_100400_c1 nmdc:mga09592_100400_c1_1590_1994 134
153 3300050511 nmdc:mga08y16_182082_c1 nmdc:mga08y16_182082_c1_135_539 134
154 3300050511 nmdc:mga08y16_560922_c1 nmdc:mga08y16_560922_c1_98_505 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

125

0.97

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

8

114

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d7z-assembly1.cif.gz_A crystal structure of glyoxalase i from zea mays 0.8271 5 127
6bnz-assembly1.cif.gz_A crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 0.8217 5 127
5hr7-assembly2.cif.gz_B x-ray crystal structure of c118a rlmn from escherichia coli with cross-linked in vitro transcribed trna 0.8208 29 56
5hr6-assembly2.cif.gz_B x-ray crystal structure of c118a rlmn with cross-linked trna purified from escherichia coli 0.8185 29 56
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.8028 4 124
ID Description Score Start End Superfamily
af_P52096_9_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8315 8 123 3.10.180.10
af_Q8III5_2_235_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.8221 29 58 3.30.830.10
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8214 8 124 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8152 2 126 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8117 2 60 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A538P972-F1-model_v4 VOC family protein 0.9253 1 106 GO:0004462
GO:0046872
AF-A0A7W1P0Z5-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9194 2 130 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A1V6DIX5-F1-model_v4 deleted 0.9162 2 131
AF-A0A3B8PZS4-F1-model_v4 Glyoxalase 0.9091 1 129 GO:0004493
GO:0046491
AF-A0A2V6EDX4-F1-model_v4 Glyoxalase 0.9051 47 130

Feature Viewer

pLDDT pTM Quality
87.98 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map