F220054

General Info

Members Datasets Scaffolds Average Seq Length
154 109 308 260

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10144649|Ga0307412_101446492
Length 265
Sequence MSPRFAPHPERRPAVVTGASSGIGAATAVALADAGHPVVLGARRVDRCEEVAARIRADGGEAGAARLDLAGPASIKDFASACEVFGPVEVLVSNAGDPQLGHAHEMAPDDFAQQVQVNLVGVQQLVALIAPGMVDRHRGDLIFVTTDSFTAPRPGMAAYVAAKWGVEGLARIMQMELEGTGVRVSVVRPGPTASEMGSSWNPDMLGPLFDEWARFGGTRHDSFLRPEQMARVIAHVVSMPRGSYISYVEVQPEAPGPDDLQGGSA

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
7 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
8 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
28 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
31 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
32 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
33 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
41 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
42 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
43 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
44 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
45 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
46 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
47 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
48 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
49 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
50 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
60 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
63 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
64 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
65 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
74 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
75 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
76 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
77 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
78 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
79 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
80 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
81 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
85 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
86 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
87 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
88 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
89 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
90 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
93 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
94 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
95 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
96 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
97 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
98 2643221576 Nocardioides sp. Root614 Isolate Unclassified
99 2643221590 Nocardioides sp. Root682 Isolate Unclassified
100 2643221604 Nocardioides sp. Root190 Isolate Unclassified
101 2643221615 Nocardioides sp. Root224 Isolate Unclassified
102 2643221617 Nocardioides sp. Root79 Isolate Unclassified
103 2643221620 Nocardioides sp. Root240 Isolate Unclassified
104 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
105 2738541305 Nocardioides sp. CF167 Isolate Unclassified
106 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
107 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
108 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
109 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.56
Metatranscriptomes 0.65
Isolates 7.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.57
Nodule 0
Rhizoplane 3.9
Rhizosphere 55.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_10144649 3300031911 Bacteria 1746
2 Ga0006562J51391_1099692 3300003578 Bacteria 1538
3 Ga0070683_100119243 3300005329 Bacteria 2492
4 Ga0070659_100033195 3300005366 Bacteria 4007
5 Ga0070714_100298192 3300005435 Bacteria 1502
6 Ga0068852_100340432 3300005616 Bacteria 1462
7 Ga0068860_100000334 3300005843 Bacteria 63958
8 Ga0081539_10095042 3300005985 Bacteria 1532
9 Ga0075365_10003548 3300006038 Bacteria 8072
10 Ga0075365_10062045 3300006038 Bacteria 2499
11 Ga0075365_10106464 3300006038 Bacteria 1924
12 Ga0075365_10118813 3300006038 Bacteria 1822
13 Ga0075365_10152970 3300006038 Bacteria 1605
14 Ga0075365_10167857 3300006038 Bacteria 1531
15 Ga0075365_10256483 3300006038 Bacteria 1229
16 Ga0075368_10008650 3300006042 Bacteria 3635
17 Ga0075368_10013660 3300006042 Bacteria 2985
18 Ga0075368_10086347 3300006042 Bacteria 1280
19 Ga0075363_100010161 3300006048 Bacteria 4453
20 Ga0075363_100027599 3300006048 Bacteria 2912
21 Ga0075363_100045210 3300006048 Bacteria 2334
22 Ga0075363_100141592 3300006048 Bacteria 1354
23 Ga0075364_10099676 3300006051 Bacteria 1934
24 Ga0075364_10233393 3300006051 Bacteria 1249
25 Ga0075367_10017820 3300006178 Bacteria 3905
26 Ga0075367_10017828 3300006178 Bacteria 3904
27 Ga0075367_10079134 3300006178 Bacteria 1986
28 Ga0075370_10026329 3300006353 Bacteria 3221
29 Ga0075370_10071379 3300006353 Bacteria 1986
30 Ga0105245_10657376 3300009098 Bacteria 1079
31 Ga0114129_10670582 3300009147 Bacteria 1336
32 Ga0105237_10171783 3300009545 Bacteria 2168
33 Ga0105239_10051034 3300010375 Bacteria 4535
34 Ga0157375_10529464 3300013308 Bacteria 1341
35 Ga0163161_10041833 3300017792 Bacteria 3294
36 Ga0207647_10299904 3300025904 Bacteria 915
37 Ga0207705_10151827 3300025909 Bacteria 1736
38 Ga0207705_10453782 3300025909 Bacteria 994
39 Ga0207649_10488070 3300025920 Bacteria 935
40 Ga0207679_10010778 3300025945 Bacteria 5895
41 Ga0207676_10762232 3300026095 Bacteria 942
42 Ga0207698_10365581 3300026142 Bacteria 1368
43 Ga0209813_10009397 3300027866 Bacteria 2501
44 Ga0268264_10000417 3300028381 Bacteria 60164
45 Ga0307515_10219113 3300028794 Bacteria 1726
46 Ga0316181_1142292 3300030744 Bacteria 1352
47 Ga0316182_1058794 3300030745 Bacteria 4579
48 Ga0265340_10002703 3300031247 Bacteria 10087
49 Ga0307513_10177034 3300031456 Bacteria 2002
50 Ga0307407_10172890 3300031903 Bacteria 1424
51 Ga0307409_100470581 3300031995 Bacteria 1217
52 Ga0307409_100471261 3300031995 Bacteria 1216
53 Ga0307409_100758527 3300031995 Bacteria 975
54 Ga0307416_100167628 3300032002 Bacteria 2040
55 Ga0373925_0064144 3300037068 Bacteria 2764
56 Ga0373925_0275801 3300037068 Bacteria 1353
57 Ga0395905_0496000 3300037471 Bacteria 1121
58 Ga0395901_0359466 3300038443 Bacteria 1502
59 Ga0439438_033520 3300041405 Bacteria 1356
60 Ga0439461_0008937 3300041410 Bacteria 1808
61 Ga0439465_0030780 3300041413 Bacteria 1708
62 Ga0451837_0332124 3300041494 Bacteria 1607
63 Ga0451841_0684704 3300041498 Bacteria 1521
64 Ga0439431_0004338 3300041997 Bacteria 3118
65 Ga0439445_0007245 3300042004 Bacteria 2570
66 Ga0439448_0008103 3300042005 Bacteria 3069
67 Ga0439432_013507 3300042006 Bacteria 2776
68 Ga0439434_0003673 3300042435 Bacteria 4486
69 Ga0466972_0083550 3300044658 Bacteria 1519
70 Ga0466965_0001725 3300044683 Bacteria 8999
71 Ga0466965_0054470 3300044683 Bacteria 1989
72 Ga0466965_0100285 3300044683 Bacteria 1480
73 Ga0466961_0012797 3300044693 Bacteria 5372
74 Ga0466961_0105828 3300044693 Bacteria 1771
75 Ga0466963_0318299 3300044694 Bacteria 1095
76 Ga0466971_0004985 3300044719 Bacteria 5744
77 Ga0466970_0006518 3300044765 Bacteria 5834
78 Ga0466970_0014416 3300044765 Bacteria 4059
79 Ga0466970_0052885 3300044765 Bacteria 2168
80 Ga0466957_0104595 3300044842 Bacteria 1788
81 Ga0466960_0006534 3300044901 Bacteria 4680
82 Ga0466960_0163392 3300044901 Bacteria 1197
83 Ga0466967_0014895 3300045976 Bacteria 6079
84 Ga0466967_0161125 3300045976 Bacteria 2106
85 Ga0466967_0260584 3300045976 Bacteria 1659
86 Ga0466967_0704976 3300045976 Bacteria 1000
87 Ga0495638_0216265 3300046460 Bacteria 1074
88 Ga0496108_0108060 3300048911 Bacteria 2376
89 Ga0496110_0080710 3300048913 Bacteria 2899
90 Ga0496111_0336570 3300048914 Bacteria 1117
91 Ga0496114_0025875 3300048917 Bacteria 4800
92 Ga0496114_0060431 3300048917 Bacteria 3168
93 Ga0496114_0210783 3300048917 Bacteria 1704
94 Ga0496124_0218200 3300048927 Bacteria 1437
95 Ga0501031_0098284 3300049568 Bacteria 1910
96 Ga0501033_0090161 3300049570 Bacteria 2243
97 Ga0501034_0648914 3300049571 Bacteria 957
98 Ga0501036_0056429 3300049572 Bacteria 3328
99 Ga0501039_0115337 3300049575 Bacteria 2102
100 Ga0501040_0286213 3300049576 Bacteria 1177
101 Ga0501041_0103287 3300049577 Bacteria 1765
102 Ga0501047_0019061 3300049581 Bacteria 6583
103 Ga0501047_0055253 3300049581 Bacteria 3840
104 Ga0501067_0076468 3300049583 Bacteria 1855
105 Ga0501069_0315231 3300049585 Bacteria 918
106 Ga0501070_0000168 3300049586 Bacteria 60303
107 Ga0501070_0168606 3300049586 Bacteria 1804
108 Ga0501070_0344378 3300049586 Bacteria 1210
109 Ga0501071_0346987 3300049587 Bacteria 1129
110 Ga0501072_0136925 3300049588 Bacteria 1952
111 Ga0501072_0390465 3300049588 Bacteria 1104
112 Ga0501074_0177880 3300049590 Bacteria 1518
113 Ga0501075_0126654 3300049591 Bacteria 1945
114 Ga0501076_0076398 3300049592 Bacteria 2686
115 Ga0501079_0349171 3300049741 Bacteria 1159
116 Ga0501080_0410683 3300049742 Bacteria 1217
117 Ga0501035_0145246 3300049822 Bacteria 2061
118 Ga0501045_0050598 3300049824 Bacteria 3032
119 nmdc:mga03n38_18525_c1 3300050490 Bacteria 2750
120 nmdc:mga03n38_90829_c1 3300050490 Bacteria 1454
121 nmdc:mga00v17_105870_c1 3300050491 Bacteria 1780
122 nmdc:mga00v17_178279_c1 3300050491 Bacteria 1371
123 nmdc:mga00v17_97175_c1 3300050491 Bacteria 1856
124 nmdc:mga00v17_99231_c1 3300050491 Bacteria 1837
125 nmdc:mga0yw44_12547_c1 3300050492 Bacteria 4423
126 nmdc:mga0yw44_236769_c1 3300050492 Bacteria 1213
127 nmdc:mga0yw44_27679_c1 3300050492 Bacteria 3251
128 nmdc:mga0yw44_483076_c1 3300050492 Bacteria 840
129 nmdc:mga0yw44_79354_c1 3300050492 Bacteria 2053
130 nmdc:mga0yw44_8095_c1 3300050492 Bacteria 5218
131 nmdc:mga0yw44_92620_c1 3300050492 Bacteria 1913
132 nmdc:mga06z11_23633_c1 3300050494 Bacteria 2891
133 nmdc:mga04h51_5309_c1 3300050495 Bacteria 3276
134 nmdc:mga07m45_35967_c1 3300050496 Bacteria 2756
135 nmdc:mga07m45_61933_c1 3300050496 Bacteria 1402
136 nmdc:mga05p37_518430_c1 3300050507 Bacteria 1364
137 Ga0500644_0000014 3300053088 Bacteria 109650
138 Ga0500641_0004874 3300053096 Bacteria 4749
139 Ga0500556_0001226 3300053104 Bacteria 11958
140 Ga0500593_000239 3300053117 Bacteria 22586
141 Ga0500573_0039886 3300053140 Bacteria 2712
142 Ga0466962_0018814 3300061719 Bacteria 3320
143 2643891942 2643221576 Bacteria 5214352
144 2643960994 2643221590 Bacteria 5214697
145 2644031854 2643221604 Bacteria 5014917
146 2644093659 2643221615 Bacteria 5487866
147 2644099831 2643221617 Bacteria 5139111
148 2644117437 2643221620 Bacteria 5134593
149 2644323501 2643221657 Bacteria 5490246
150 2738870812 2738541305 Bacteria 4910150
151 2809196300 2808606439 Bacteria 5952208
152 2812334674 2811994874 Bacteria 5367947
153 2855389641 2855386786 Bacteria 4752232
154 2891970855 2891968417 Bacteria 5821697
155 Ga0307412_10144649
156 Ga0006562J51391_1099692
157 Ga0070683_100119243
158 Ga0070659_100033195
159 Ga0070714_100298192
160 Ga0068852_100340432
161 Ga0068860_100000334
162 Ga0081539_10095042
163 Ga0075365_10003548
164 Ga0075365_10062045
165 Ga0075365_10106464
166 Ga0075365_10118813
167 Ga0075365_10152970
168 Ga0075365_10167857
169 Ga0075365_10256483
170 Ga0075368_10008650
171 Ga0075368_10013660
172 Ga0075368_10086347
173 Ga0075363_100010161
174 Ga0075363_100027599
175 Ga0075363_100045210
176 Ga0075363_100141592
177 Ga0075364_10099676
178 Ga0075364_10233393
179 Ga0075367_10017820
180 Ga0075367_10017828
181 Ga0075367_10079134
182 Ga0075370_10026329
183 Ga0075370_10071379
184 Ga0105245_10657376
185 Ga0114129_10670582
186 Ga0105237_10171783
187 Ga0105239_10051034
188 Ga0157375_10529464
189 Ga0163161_10041833
190 Ga0207647_10299904
191 Ga0207705_10151827
192 Ga0207705_10453782
193 Ga0207649_10488070
194 Ga0207679_10010778
195 Ga0207676_10762232
196 Ga0207698_10365581
197 Ga0209813_10009397
198 Ga0268264_10000417
199 Ga0307515_10219113
200 Ga0316181_1142292
201 Ga0316182_1058794
202 Ga0265340_10002703
203 Ga0307513_10177034
204 Ga0307407_10172890
205 Ga0307409_100470581
206 Ga0307409_100471261
207 Ga0307409_100758527
208 Ga0307416_100167628
209 Ga0373925_0064144
210 Ga0373925_0275801
211 Ga0395905_0496000
212 Ga0395901_0359466
213 Ga0439438_033520
214 Ga0439461_0008937
215 Ga0439465_0030780
216 Ga0451837_0332124
217 Ga0451841_0684704
218 Ga0439431_0004338
219 Ga0439445_0007245
220 Ga0439448_0008103
221 Ga0439432_013507
222 Ga0439434_0003673
223 Ga0466972_0083550
224 Ga0466965_0001725
225 Ga0466965_0054470
226 Ga0466965_0100285
227 Ga0466961_0012797
228 Ga0466961_0105828
229 Ga0466963_0318299
230 Ga0466971_0004985
231 Ga0466970_0006518
232 Ga0466970_0014416
233 Ga0466970_0052885
234 Ga0466957_0104595
235 Ga0466960_0006534
236 Ga0466960_0163392
237 Ga0466967_0014895
238 Ga0466967_0161125
239 Ga0466967_0260584
240 Ga0466967_0704976
241 Ga0495638_0216265
242 Ga0496108_0108060
243 Ga0496110_0080710
244 Ga0496111_0336570
245 Ga0496114_0025875
246 Ga0496114_0060431
247 Ga0496114_0210783
248 Ga0496124_0218200
249 Ga0501031_0098284
250 Ga0501033_0090161
251 Ga0501034_0648914
252 Ga0501036_0056429
253 Ga0501039_0115337
254 Ga0501040_0286213
255 Ga0501041_0103287
256 Ga0501047_0019061
257 Ga0501047_0055253
258 Ga0501067_0076468
259 Ga0501069_0315231
260 Ga0501070_0000168
261 Ga0501070_0168606
262 Ga0501070_0344378
263 Ga0501071_0346987
264 Ga0501072_0136925
265 Ga0501072_0390465
266 Ga0501074_0177880
267 Ga0501075_0126654
268 Ga0501076_0076398
269 Ga0501079_0349171
270 Ga0501080_0410683
271 Ga0501035_0145246
272 Ga0501045_0050598
273 nmdc:mga03n38_18525_c1
274 nmdc:mga03n38_90829_c1
275 nmdc:mga00v17_105870_c1
276 nmdc:mga00v17_178279_c1
277 nmdc:mga00v17_97175_c1
278 nmdc:mga00v17_99231_c1
279 nmdc:mga0yw44_12547_c1
280 nmdc:mga0yw44_236769_c1
281 nmdc:mga0yw44_27679_c1
282 nmdc:mga0yw44_483076_c1
283 nmdc:mga0yw44_79354_c1
284 nmdc:mga0yw44_8095_c1
285 nmdc:mga0yw44_92620_c1
286 nmdc:mga06z11_23633_c1
287 nmdc:mga04h51_5309_c1
288 nmdc:mga07m45_35967_c1
289 nmdc:mga07m45_61933_c1
290 nmdc:mga05p37_518430_c1
291 Ga0500644_0000014
292 Ga0500641_0004874
293 Ga0500556_0001226
294 Ga0500593_000239
295 Ga0500573_0039886
296 Ga0466962_0018814
297 2643891942
298 2643960994
299 2644031854
300 2644093659
301 2644099831
302 2644117437
303 2644323501
304 2738870812
305 2809196300
306 2812334674
307 2855389641
308 2891970855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

12

205

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

18

246

0.85

PF08659

KR

KR domain

14

189

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ew8-assembly1.cif.gz_D crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9636 10 188
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9572 9 253
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9558 10 251
1w8d-assembly1.cif.gz_B binary structure of human decr. 0.9495 10 192
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9486 9 253
ID Description Score Start End Superfamily
af_I6WZD9_7_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9823 6 258 3.40.50.720
af_I6WZD9_7_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9746 6 258 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9588 10 187 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9572 9 253 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9543 10 198 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2S8MAZ9-F1-model_v4 deleted 0.979 65 257
AF-A0A2W6T3P7-F1-model_v4 Short-chain dehydrogenase 0.9671 10 188 GO:0016491
AF-A0A1A2N6M4-F1-model_v4 Dehydrogenase 0.9634 10 195 GO:0016491
AF-A0A0S8HCE5-F1-model_v4 Short-chain dehydrogenase 0.9633 9 168 GO:0016491
AF-A0A843FG90-F1-model_v4 deleted 0.9631 10 162

Map