F219629

General Info

Members Datasets Scaffolds Average Seq Length
154 104 308 544

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10046687|Ga0157369_100466874
Length 584
Sequence MSRKIRSVHRLGLGAVVGGLVVLTALVVVAIAIAAPKSGSAVDRLTASHKCLVMAGSGDPAFVKNFNPYTATSLPSGGFVRGAFYEPLIITTAAGGGHQYPWLAQSWKWSNHNKTLTLNIRKGVKWSDRKALTSADVVYSLTAGKQNAVMDLIGYTHPNSNVVSIKAKGAYSVVINLRTVDSQFIAATLNGQFVVPKHIWSKVANPATFTNPHPVGSGPFNQVAKFNTQDYVLGKNPHYWLKGAPKIPCLEYVQAASNDAALALIQSGQVDWTHNFVPNVQQAYVSKDPSHYHAFYATTAYPISLVFDDTSYPYSMPAFRKALSLAIDRNSVSKLGEYGYAPPTDALGLGGIFPTYYTPAIKAAAKAAATYDPAKAKAALQAAGFTYKGSQLIDPKGNPVNLDIHVISGWSDWVASNGIITKNLSAIGISSKVALEPDWGSWQPNAMSTKNPSLLWQGASQASPYGFFLSNLSEALFTPSGQDASATGNWEHFKDPASTPILNDWRSSLNPEQQQADFVKLANMFLKDQPIIPLFIGPRWSTYSTKYFHGFTSPKNYFTDPIFTQAPDNVLNFTRIAPGGSAGA

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
48 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
49 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
50 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
60 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
61 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
62 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
63 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
64 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
65 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
66 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
73 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
74 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
75 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
76 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
92 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
96 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
97 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.82
Metatranscriptomes 18.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.04
Rhizosphere 88.31
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10046687 3300013105 Bacteria 4707
2 JGI25406J46586_10003447 3300003203 Bacteria 7432
3 Ga0007417J51691_1025689 3300003544 Unclassified 1895
4 Ga0007409J51694_1019137 3300003575 Unclassified 2031
5 Ga0007416J51690_1034991 3300003577 Unclassified 1783
6 Ga0058861_10021473 3300004800 Bacteria 2114
7 Ga0070658_10080167 3300005327 Bacteria 2681
8 Ga0070683_100000373 3300005329 Bacteria 31119
9 Ga0070660_100008392 3300005339 Bacteria 7222
10 Ga0070661_100004693 3300005344 Bacteria 9411
11 Ga0070709_10015584 3300005434 Bacteria 4328
12 Ga0070714_100012240 3300005435 Bacteria 6843
13 Ga0070714_100022115 3300005435 Bacteria 5211
14 Ga0070714_100059212 3300005435 Bacteria 3283
15 Ga0070698_100025921 3300005471 Bacteria 6107
16 Ga0070698_100063567 3300005471 Bacteria 3722
17 Ga0070699_100020229 3300005518 Bacteria 5738
18 Ga0070679_100104228 3300005530 Unclassified 2823
19 Ga0070684_100031363 3300005535 Bacteria 4524
20 Ga0068853_100102169 3300005539 Bacteria 2537
21 Ga0068853_100123079 3300005539 Bacteria 2316
22 Ga0070696_100048822 3300005546 Bacteria 2938
23 Ga0068855_100027785 3300005563 Bacteria 6768
24 Ga0068855_100165249 3300005563 Bacteria 2510
25 Ga0068856_100135659 3300005614 Bacteria 2466
26 Ga0081455_10012645 3300005937 Bacteria 8406
27 Ga0081455_10054639 3300005937 Bacteria 3402
28 Ga0081539_10000244 3300005985 Bacteria 127514
29 Ga0081539_10002001 3300005985 Bacteria 30908
30 Ga0081539_10072743 3300005985 Unclassified 1836
31 Ga0070712_100083905 3300006175 Bacteria 2315
32 Ga0105240_10039587 3300009093 Bacteria 6035
33 Ga0105245_10065757 3300009098 Bacteria 3280
34 Ga0114129_10038922 3300009147 Bacteria 6703
35 Ga0105237_10094764 3300009545 Bacteria 2974
36 Ga0157370_10012716 3300013104 Bacteria 8711
37 Ga0157370_10029996 3300013104 Bacteria 5331
38 Ga0157369_10007664 3300013105 Bacteria 12418
39 Ga0157369_10032875 3300013105 Bacteria 5701
40 Ga0197907_10151099 3300020069 Unclassified 2211
41 Ga0197907_10310484 3300020069 Bacteria 3451
42 Ga0197907_10566573 3300020069 Bacteria 1784
43 Ga0206356_10695509 3300020070 Unclassified 3117
44 Ga0206356_11838400 3300020070 Bacteria 2032
45 Ga0206349_1179640 3300020075 Bacteria 1849
46 Ga0206352_10693864 3300020078 Unclassified 1794
47 Ga0206354_11209526 3300020081 Bacteria 2371
48 Ga0206353_10649853 3300020082 Bacteria 9290
49 Ga0206353_11667372 3300020082 Bacteria 1803
50 Ga0224712_10012632 3300022467 Bacteria 2663
51 Ga0224712_10023366 3300022467 Bacteria 2146
52 Ga0224712_10036404 3300022467 Bacteria 1824
53 Ga0207705_10019847 3300025909 Bacteria 4807
54 Ga0207705_10029323 3300025909 Bacteria 3922
55 Ga0207707_10043330 3300025912 Unclassified 3926
56 Ga0207660_10134721 3300025917 Unclassified 1884
57 Ga0207657_10001017 3300025919 Bacteria 29789
58 Ga0207657_10002085 3300025919 Bacteria 21637
59 Ga0207657_10014300 3300025919 Bacteria 7752
60 Ga0207694_10040853 3300025924 Bacteria 3573
61 Ga0207687_10053013 3300025927 Unclassified 2832
62 Ga0207661_10011227 3300025944 Bacteria 6481
63 Ga0207675_100111126 3300026118 Bacteria 2586
64 Ga0265319_1007636 3300028563 Bacteria 4831
65 Ga0265318_10023170 3300028577 Bacteria 2476
66 Ga0265338_10005702 3300028800 Bacteria 16109
67 Ga0265320_10019413 3300031240 Bacteria 3717
68 Ga0373944_0010309 3300035089 Unclassified 2546
69 Ga0395899_0032356 3300037312 Bacteria 3928
70 Ga0395899_0059737 3300037312 Bacteria 2811
71 Ga0395900_0005947 3300037418 Bacteria 12737
72 Ga0395900_0037921 3300037418 Bacteria 4969
73 Ga0395900_0089779 3300037418 Bacteria 3158
74 Ga0395898_0000926 3300037466 Bacteria 46928
75 Ga0395898_0031875 3300037466 Bacteria 5263
76 Ga0395898_0051220 3300037466 Bacteria 4038
77 Ga0395905_0038855 3300037471 Bacteria 4464
78 Ga0395901_0003665 3300038443 Bacteria 15488
79 Ga0395901_0007702 3300038443 Bacteria 10860
80 Ga0395901_0026099 3300038443 Bacteria 5998
81 Ga0395901_0054530 3300038443 Bacteria 4155
82 Ga0395901_0162554 3300038443 Bacteria 2345
83 Ga0395901_0204948 3300038443 Bacteria 2066
84 Ga0395901_0292725 3300038443 Bacteria 1689
85 Ga0439446_0012863 3300042156 Unclassified 2290
86 Ga0466963_0005379 3300044694 Bacteria 7494
87 Ga0466963_0007117 3300044694 Bacteria 6664
88 Ga0466959_0049314 3300045049 Bacteria 3093
89 Ga0466958_0007971 3300045836 Bacteria 5854
90 Ga0466958_0014912 3300045836 Bacteria 4443
91 Ga0466958_0073168 3300045836 Bacteria 2099
92 Ga0466967_0009202 3300045976 Bacteria 7312
93 Ga0466967_0011208 3300045976 Bacteria 6776
94 Ga0466967_0041834 3300045976 Bacteria 3955
95 Ga0466967_0064664 3300045976 Bacteria 3253
96 Ga0495592_0106069 3300046454 Unclassified 1995
97 Ga0495592_0111006 3300046454 Bacteria 1940
98 Ga0495603_0017895 3300046455 Bacteria 4289
99 Ga0495629_0094539 3300046459 Bacteria 2086
100 Ga0495641_0028186 3300046461 Bacteria 2720
101 Ga0495651_0080136 3300046462 Bacteria 2467
102 Ga0495653_0056622 3300046463 Bacteria 2988
103 Ga0495582_0011798 3300046473 Bacteria 4813
104 Ga0495639_0093525 3300046475 Bacteria 1413
105 Ga0495608_0100096 3300046511 Bacteria 1869
106 Ga0495618_0062152 3300046514 Bacteria 2369
107 Ga0495628_0031505 3300046516 Bacteria 4289
108 Ga0495630_0023281 3300046517 Bacteria 4579
109 Ga0495640_0025977 3300046533 Bacteria 4241
110 Ga0495635_0008545 3300046663 Bacteria 7151
111 Ga0495658_0103604 3300046683 Bacteria 1702
112 Ga0495674_0008098 3300047319 Bacteria 10028
113 Ga0495680_0006241 3300047322 Bacteria 11112
114 Ga0495680_0031903 3300047322 Bacteria 4283
115 Ga0495680_0060609 3300047322 Bacteria 2916
116 Ga0495684_0094658 3300047471 Bacteria 2261
117 Ga0496100_0009918 3300048903 Bacteria 5371
118 Ga0496101_0022439 3300048904 Bacteria 4345
119 Ga0496101_0096077 3300048904 Bacteria 2211
120 Ga0496101_0153568 3300048904 Bacteria 1762
121 Ga0496102_0059273 3300048905 Bacteria 3500
122 Ga0496104_0051589 3300048907 Bacteria 3883
123 Ga0496105_0039380 3300048908 Bacteria 3895
124 Ga0496105_0056162 3300048908 Bacteria 3250
125 Ga0496106_0008645 3300048909 Bacteria 7536
126 Ga0496107_0033247 3300048910 Bacteria 3689
127 Ga0496109_0096211 3300048912 Bacteria 2743
128 Ga0496110_0060606 3300048913 Unclassified 3338
129 Ga0496110_0109307 3300048913 Bacteria 2483
130 Ga0496112_0050597 3300048915 Bacteria 4075
131 Ga0496114_0015948 3300048917 Bacteria 6046
132 Ga0496114_0040643 3300048917 Bacteria 3851
133 Ga0496115_0133601 3300048918 Unclassified 2045
134 Ga0496126_0028808 3300048929 Bacteria 5285
135 Ga0501047_0078522 3300049581 Bacteria 3174
136 Ga0501067_0013271 3300049583 Bacteria 4562
137 Ga0501069_0009892 3300049585 Bacteria 5043
138 Ga0501070_0093856 3300049586 Bacteria 2482
139 Ga0501070_0100463 3300049586 Bacteria 2393
140 Ga0501080_0081362 3300049742 Bacteria 3009
141 Ga0495601_0099619 3300053077 Bacteria 1876
142 Ga0495619_0048882 3300053085 Bacteria 2787
143 Ga0587073_0003945 3300059492 Unclassified 2085
144 Ga0587073_0006493 3300059492 Bacteria 1802
145 Ga0587086_001998 3300059507 Bacteria 1854
146 Ga0587091_004154 3300059511 Unclassified 1879
147 Ga0587092_002731 3300059512 Bacteria 1923
148 Ga0587062_002040 3300059639 Bacteria 1869
149 Ga0587071_006516 3300060344 Unclassified 1827
150 Ga0587111_0005078 3300060346 Unclassified 2006
151 Ga0587111_0005159 3300060346 Unclassified 1993
152 Ga0587111_0006170 3300060346 Bacteria 1888
153 Ga0587111_0007078 3300060346 Unclassified 1808
154 Ga0466962_0042490 3300061719 Bacteria 2176
155 Ga0157369_10046687
156 JGI25406J46586_10003447
157 Ga0007417J51691_1025689
158 Ga0007409J51694_1019137
159 Ga0007416J51690_1034991
160 Ga0058861_10021473
161 Ga0070658_10080167
162 Ga0070683_100000373
163 Ga0070660_100008392
164 Ga0070661_100004693
165 Ga0070709_10015584
166 Ga0070714_100012240
167 Ga0070714_100022115
168 Ga0070714_100059212
169 Ga0070698_100025921
170 Ga0070698_100063567
171 Ga0070699_100020229
172 Ga0070679_100104228
173 Ga0070684_100031363
174 Ga0068853_100102169
175 Ga0068853_100123079
176 Ga0070696_100048822
177 Ga0068855_100027785
178 Ga0068855_100165249
179 Ga0068856_100135659
180 Ga0081455_10012645
181 Ga0081455_10054639
182 Ga0081539_10000244
183 Ga0081539_10002001
184 Ga0081539_10072743
185 Ga0070712_100083905
186 Ga0105240_10039587
187 Ga0105245_10065757
188 Ga0114129_10038922
189 Ga0105237_10094764
190 Ga0157370_10012716
191 Ga0157370_10029996
192 Ga0157369_10007664
193 Ga0157369_10032875
194 Ga0197907_10151099
195 Ga0197907_10310484
196 Ga0197907_10566573
197 Ga0206356_10695509
198 Ga0206356_11838400
199 Ga0206349_1179640
200 Ga0206352_10693864
201 Ga0206354_11209526
202 Ga0206353_10649853
203 Ga0206353_11667372
204 Ga0224712_10012632
205 Ga0224712_10023366
206 Ga0224712_10036404
207 Ga0207705_10019847
208 Ga0207705_10029323
209 Ga0207707_10043330
210 Ga0207660_10134721
211 Ga0207657_10001017
212 Ga0207657_10002085
213 Ga0207657_10014300
214 Ga0207694_10040853
215 Ga0207687_10053013
216 Ga0207661_10011227
217 Ga0207675_100111126
218 Ga0265319_1007636
219 Ga0265318_10023170
220 Ga0265338_10005702
221 Ga0265320_10019413
222 Ga0373944_0010309
223 Ga0395899_0032356
224 Ga0395899_0059737
225 Ga0395900_0005947
226 Ga0395900_0037921
227 Ga0395900_0089779
228 Ga0395898_0000926
229 Ga0395898_0031875
230 Ga0395898_0051220
231 Ga0395905_0038855
232 Ga0395901_0003665
233 Ga0395901_0007702
234 Ga0395901_0026099
235 Ga0395901_0054530
236 Ga0395901_0162554
237 Ga0395901_0204948
238 Ga0395901_0292725
239 Ga0439446_0012863
240 Ga0466963_0005379
241 Ga0466963_0007117
242 Ga0466959_0049314
243 Ga0466958_0007971
244 Ga0466958_0014912
245 Ga0466958_0073168
246 Ga0466967_0009202
247 Ga0466967_0011208
248 Ga0466967_0041834
249 Ga0466967_0064664
250 Ga0495592_0106069
251 Ga0495592_0111006
252 Ga0495603_0017895
253 Ga0495629_0094539
254 Ga0495641_0028186
255 Ga0495651_0080136
256 Ga0495653_0056622
257 Ga0495582_0011798
258 Ga0495639_0093525
259 Ga0495608_0100096
260 Ga0495618_0062152
261 Ga0495628_0031505
262 Ga0495630_0023281
263 Ga0495640_0025977
264 Ga0495635_0008545
265 Ga0495658_0103604
266 Ga0495674_0008098
267 Ga0495680_0006241
268 Ga0495680_0031903
269 Ga0495680_0060609
270 Ga0495684_0094658
271 Ga0496100_0009918
272 Ga0496101_0022439
273 Ga0496101_0096077
274 Ga0496101_0153568
275 Ga0496102_0059273
276 Ga0496104_0051589
277 Ga0496105_0039380
278 Ga0496105_0056162
279 Ga0496106_0008645
280 Ga0496107_0033247
281 Ga0496109_0096211
282 Ga0496110_0060606
283 Ga0496110_0109307
284 Ga0496112_0050597
285 Ga0496114_0015948
286 Ga0496114_0040643
287 Ga0496115_0133601
288 Ga0496126_0028808
289 Ga0501047_0078522
290 Ga0501067_0013271
291 Ga0501069_0009892
292 Ga0501070_0093856
293 Ga0501070_0100463
294 Ga0501080_0081362
295 Ga0495601_0099619
296 Ga0495619_0048882
297 Ga0587073_0003945
298 Ga0587073_0006493
299 Ga0587086_001998
300 Ga0587091_004154
301 Ga0587092_002731
302 Ga0587062_002040
303 Ga0587071_006516
304 Ga0587111_0005078
305 Ga0587111_0005159
306 Ga0587111_0006170
307 Ga0587111_0007078
308 Ga0466962_0042490

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00496

SBP_bac_5

Bacterial extracellular solute-binding proteins, family 5 Middle

98

476

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vr5-assembly1.cif.gz_A crystal structure of oligopeptide abc transporter, periplasmic oligopeptide-binding (tm1223) from thermotoga maritima at 1.73 a resolution 0.8746 11 533
6lzw-assembly1.cif.gz_A w513a mutant of chitin-specific solute binding protein from vibrio harveyi co-crystalized with chitobiose. 0.8569 12 533
6lzu-assembly1.cif.gz_A f411a mutant of chitin-specific solute binding protein from vibrio harveyi co-crystalized with chitobiose. 0.8539 12 533
1vr5-assembly1.cif.gz_A crystal structure of oligopeptide abc transporter, periplasmic oligopeptide-binding (tm1223) from thermotoga maritima at 1.73 a resolution 0.8529 11 533
6lzw-assembly1.cif.gz_A w513a mutant of chitin-specific solute binding protein from vibrio harveyi co-crystalized with chitobiose. 0.8524 12 533
ID Description Score Start End Superfamily
1iiwA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9886 213 234 3.40.190.10
1zu0A02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.8526 47 157 3.90.76.10
1zu0A02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.8453 47 157 3.90.76.10
1vr5A03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.8434 259 489 3.10.105.10
3nohA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.841 354 407 3.40.190.210
ID Description Score Start End GO Terms
AF-A0A4Q0YRX4-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.913 12 214 GO:0030288
GO:0042938
GO:1904680
AF-A0A7C2J2Q1-F1-model_v4 deleted 0.9092 12 533
AF-A0A444QGM3-F1-model_v4 ABC transporter substrate-binding protein 0.906 16 539 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A444QGM3-F1-model_v4 ABC transporter substrate-binding protein 0.9026 16 539 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A7Y6CE93-F1-model_v4 ABC transporter substrate-binding protein 0.9016 1 537 GO:0015833
GO:0042597
GO:0043190
GO:1904680

Map