F214753

General Info

Members Datasets Scaffolds Average Seq Length
152 124 152 211

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10034191|Ga0307508_100341913
Length 218
Sequence VTRLVLRLADRHDWVKVFDPRGSSIFVAAETPPPVGTQVRVDLTIEDGGPRVILRGAVLWCRDADEADAKDPAGCGVALVAADREKINFLNGFVRGGLLNRRERRRLPLRLPVTFGGLDGPEQTFTRDINEEGMFILADEPLPEQTLLHFVLAVPGQAEPVELKGTVSHTVITADDDVPGMGVRYVLDDPARAAEMMAIVDRLEQEFLAGMLPDDVIS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
88 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
94 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
95 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
103 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
104 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
105 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
106 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
107 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
108 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
109 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
110 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
111 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
112 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
113 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
114 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
115 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
116 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
117 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
118 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
119 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
120 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
121 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
122 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
123 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
124 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.45
Nodule 0
Rhizoplane 0.66
Rhizosphere 76.32
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100752524 3300005329 Unclassified 934
2 Ga0070690_100012344 3300005330 Bacteria 5026
3 Ga0068869_100107547 3300005334 Bacteria 2118
4 Ga0068869_100350168 3300005334 Bacteria 1204
5 Ga0070682_100302984 3300005337 Bacteria 1173
6 Ga0070689_100033306 3300005340 Bacteria 3925
7 Ga0070689_100361595 3300005340 Bacteria 1220
8 Ga0070669_100120451 3300005353 Unclassified 2001
9 Ga0070688_100178005 3300005365 Unclassified 1473
10 Ga0070667_100311805 3300005367 Bacteria 1418
11 Ga0070708_100264167 3300005445 Bacteria 1618
12 Ga0070678_100015261 3300005456 Bacteria 4877
13 Ga0070681_10100796 3300005458 Bacteria 2834
14 Ga0070681_10299185 3300005458 Bacteria 1519
15 Ga0070681_10579523 3300005458 Unclassified 1036
16 Ga0070706_100247406 3300005467 Unclassified 1665
17 Ga0070698_100000489 3300005471 Bacteria 42118
18 Ga0070679_100097855 3300005530 Bacteria 2921
19 Ga0070684_100719602 3300005535 Unclassified 931
20 Ga0070695_100268790 3300005545 Unclassified 1248
21 Ga0070665_100012038 3300005548 Bacteria 8725
22 Ga0068855_100369033 3300005563 Bacteria 1578
23 Ga0068856_100033864 3300005614 Bacteria 5003
24 Ga0068864_100079514 3300005618 Bacteria 2871
25 Ga0068861_100733572 3300005719 Bacteria 921
26 Ga0068863_100158254 3300005841 Bacteria 2169
27 Ga0068863_100740189 3300005841 Unclassified 979
28 Ga0070717_10012257 3300006028 Bacteria 6536
29 Ga0070717_10384706 3300006028 Bacteria 1258
30 Ga0075434_100158560 3300006871 Bacteria 2282
31 Ga0075429_100041888 3300006880 Bacteria 3987
32 Ga0068865_100017385 3300006881 Bacteria 4626
33 Ga0075436_100225934 3300006914 Unclassified 1329
34 Ga0075435_100563808 3300007076 Unclassified 987
35 Ga0105240_11269216 3300009093 Unclassified 778
36 Ga0111539_10176261 3300009094 Unclassified 2497
37 Ga0105245_10000011 3300009098 Bacteria 271829
38 Ga0114129_10757887 3300009147 Bacteria 1242
39 Ga0105242_10355137 3300009176 Bacteria 1355
40 Ga0105237_10461339 3300009545 Bacteria 1276
41 Ga0105249_10030565 3300009553 Bacteria 4870
42 Ga0105249_10084489 3300009553 Bacteria 2956
43 Ga0105239_10200035 3300010375 Bacteria 2238
44 Ga0157374_10078809 3300013296 Bacteria 3121
45 Ga0157378_10385826 3300013297 Bacteria 1377
46 Ga0163163_10500382 3300014325 Bacteria 1277
47 Ga0163163_11386286 3300014325 Bacteria 765
48 Ga0157376_10009401 3300014969 Bacteria 7101
49 Ga0157376_10271470 3300014969 Bacteria 1593
50 Ga0157376_11321123 3300014969 Bacteria 751
51 Ga0207684_10204787 3300025910 Unclassified 1702
52 Ga0207707_10395259 3300025912 Unclassified 1187
53 Ga0207652_10090400 3300025921 Bacteria 2690
54 Ga0207652_10772193 3300025921 Unclassified 854
55 Ga0207659_10190960 3300025926 Bacteria 1630
56 Ga0207687_10000016 3300025927 Bacteria 250284
57 Ga0207687_10030838 3300025927 Bacteria 3618
58 Ga0207670_10013995 3300025936 Bacteria 4749
59 Ga0207689_10114536 3300025942 Bacteria 2216
60 Ga0207689_10276805 3300025942 Bacteria 1389
61 Ga0207661_10829749 3300025944 Unclassified 851
62 Ga0207712_10116127 3300025961 Bacteria 2016
63 Ga0207668_10763257 3300025972 Bacteria 854
64 Ga0207702_10262680 3300026078 Bacteria 1626
65 Ga0207641_10140532 3300026088 Bacteria 2178
66 Ga0207641_10751969 3300026088 Unclassified 962
67 Ga0207675_100053433 3300026118 Bacteria 3769
68 Ga0207675_100106897 3300026118 Bacteria 2638
69 Ga0207683_10014220 3300026121 Bacteria 6779
70 Ga0268266_10023286 3300028379 Bacteria 5273
71 Ga0268265_10140459 3300028380 Bacteria 2022
72 Ga0268264_10224196 3300028381 Bacteria 1732
73 Ga0307517_10068436 3300028786 Bacteria 3235
74 Ga0307515_10005117 3300028794 Bacteria 26646
75 Ga0265338_10043507 3300028800 Bacteria 4164
76 Ga0307511_10127249 3300030521 Bacteria 1549
77 Ga0265332_10020594 3300031238 Bacteria 2911
78 Ga0307513_10001148 3300031456 Bacteria 38426
79 Ga0307509_10001723 3300031507 Bacteria 36447
80 Ga0307509_10004133 3300031507 Bacteria 21207
81 Ga0307509_10221558 3300031507 Bacteria 1704
82 Ga0307508_10034191 3300031616 Bacteria 4584
83 Ga0307508_10127840 3300031616 Bacteria 2144
84 Ga0307406_10128373 3300031901 Unclassified 1775
85 Ga0307406_10277693 3300031901 Bacteria 1276
86 Ga0307415_100222448 3300032126 Unclassified 1514
87 Ga0373949_0000813 3300035090 Bacteria 9947
88 Ga0373936_0000017 3300035113 Bacteria 165713
89 Ga0373941_0231583 3300035115 Unclassified 714
90 Ga0373956_0038598 3300035119 Bacteria 2113
91 Ga0373961_0000217 3300035241 Bacteria 27253
92 Ga0373933_0529277 3300035724 Bacteria 773
93 Ga0395899_0026559 3300037312 Bacteria 4368
94 Ga0395899_0248224 3300037312 Unclassified 1222
95 Ga0395900_0273729 3300037418 Unclassified 1682
96 Ga0395905_0108428 3300037471 Bacteria 2607
97 Ga0395905_0504754 3300037471 Bacteria 1110
98 Ga0395901_0072981 3300038443 Bacteria 3578
99 Ga0436365_0319901 3300039437 Bacteria 2488
100 Ga0466963_0118844 3300044694 Bacteria 1818
101 Ga0495622_0060641 3300046557 Bacteria 1752
102 Ga0495686_0014716 3300047472 Bacteria 5377
103 Ga0495686_0212018 3300047472 Unclassified 1106
104 Ga0496104_0613116 3300048907 Unclassified 998
105 Ga0501033_0223072 3300049570 Bacteria 1341
106 Ga0501034_0145022 3300049571 Bacteria 2352
107 Ga0501036_0240658 3300049572 Bacteria 1518
108 Ga0501047_0053317 3300049581 Bacteria 3910
109 Ga0501047_0568190 3300049581 Bacteria 957
110 Ga0501067_0158541 3300049583 Bacteria 1260
111 Ga0501069_0007164 3300049585 Bacteria 5846
112 Ga0501070_0070682 3300049586 Bacteria 2890
113 Ga0501070_0155333 3300049586 Bacteria 1886
114 Ga0501072_0504316 3300049588 Bacteria 957
115 Ga0501073_0262110 3300049589 Bacteria 1193
116 Ga0501074_0516475 3300049590 Bacteria 846
117 Ga0501209_035180 3300049656 Bacteria 1296
118 Ga0501216_001418 3300049660 Bacteria 3233
119 Ga0501230_005004 3300049667 Bacteria 1855
120 Ga0501080_0068142 3300049742 Bacteria 3310
121 Ga0501083_0093655 3300049744 Bacteria 1983
122 Ga0501035_0212473 3300049822 Bacteria 1655
123 Ga0501044_0144926 3300049823 Bacteria 2361
124 Ga0501044_0764761 3300049823 Bacteria 847
125 nmdc:mga09592_56828_c1 3300050508 Bacteria 3307
126 nmdc:mga09592_580670_c1 3300050508 Unclassified 961
127 nmdc:mga08x19_218154_c1 3300050514 Unclassified 1310
128 Ga0500635_0041633 3300053080 Bacteria 1537
129 Ga0500647_0044618 3300053091 Bacteria 2128
130 Ga0500583_0022049 3300053092 Bacteria 2662
131 Ga0500566_0001005 3300053094 Bacteria 16241
132 Ga0500566_0004836 3300053094 Bacteria 8033
133 Ga0500566_0130765 3300053094 Bacteria 1343
134 Ga0500640_005013 3300053095 Bacteria 4882
135 Ga0500554_000449 3300053102 Bacteria 8688
136 Ga0500556_0152141 3300053104 Unclassified 912
137 Ga0500572_005755 3300053111 Bacteria 2821
138 Ga0500595_000074 3300053119 Bacteria 69645
139 Ga0500597_055044 3300053120 Bacteria 1701
140 Ga0500614_010780 3300053123 Bacteria 1967
141 Ga0500642_0044148 3300053130 Bacteria 1940
142 Ga0500559_0012281 3300053136 Bacteria 3644
143 Ga0500564_096531 3300053138 Bacteria 1311
144 Ga0500568_0006488 3300053139 Bacteria 5866
145 Ga0500585_020576 3300053144 Bacteria 2154
146 Ga0500603_007876 3300053150 Bacteria 2347
147 Ga0500630_025117 3300053159 Bacteria 2941
148 Ga0500639_013887 3300053163 Bacteria 4236
149 Ga0500636_0120943 3300053177 Unclassified 1469
150 Ga0500637_0066282 3300053178 Bacteria 2073
151 Ga0500596_007924 3300053735 Bacteria 1715
152 Ga0500601_007708 3300053737 Bacteria 1194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031901 Ga0307406_10277693 Ga0307406_102776932 202
2 3300028794 Ga0307515_10005117 Ga0307515_100051178 205
3 3300005563 Ga0068855_100369033 Ga0068855_1003690332 206
4 3300009093 Ga0105240_11269216 Ga0105240_112692161 206
5 3300005353 Ga0070669_100120451 Ga0070669_1001204512 207
6 3300005467 Ga0070706_100247406 Ga0070706_1002474061 207
7 3300005548 Ga0070665_100012038 Ga0070665_1000120386 207
8 3300009094 Ga0111539_10176261 Ga0111539_101762612 207
9 3300009147 Ga0114129_10757887 Ga0114129_107578871 207
10 3300014969 Ga0157376_10271470 Ga0157376_102714702 207
11 3300025910 Ga0207684_10204787 Ga0207684_102047872 207
12 3300025926 Ga0207659_10190960 Ga0207659_101909602 207
13 3300028379 Ga0268266_10023286 Ga0268266_100232862 207
14 3300053092 Ga0500583_0022049 Ga0500583_0022049_1497_2147 207
15 3300005535 Ga0070684_100719602 Ga0070684_1007196021 208
16 3300013296 Ga0157374_10078809 Ga0157374_100788092 208
17 3300031616 Ga0307508_10034191 Ga0307508_100341913 208
18 3300037312 Ga0395899_0026559 Ga0395899_0026559_1970_2596 208
19 3300037312 Ga0395899_0248224 Ga0395899_0248224_144_770 208
20 3300037418 Ga0395900_0273729 Ga0395900_0273729_584_1210 208
21 3300037471 Ga0395905_0108428 Ga0395905_0108428_1752_2378 208
22 3300038443 Ga0395901_0072981 Ga0395901_0072981_358_984 208
23 3300039437 Ga0436365_0319901 Ga0436365_0319901_1332_1958 208
24 3300044694 Ga0466963_0118844 Ga0466963_0118844_86_718 208
25 3300049570 Ga0501033_0223072 Ga0501033_0223072_236_862 208
26 3300049571 Ga0501034_0145022 Ga0501034_0145022_518_1144 208
27 3300049572 Ga0501036_0240658 Ga0501036_0240658_319_945 208
28 3300049581 Ga0501047_0053317 Ga0501047_0053317_680_1321 208
29 3300049581 Ga0501047_0568190 Ga0501047_0568190_23_649 208
30 3300049586 Ga0501070_0070682 Ga0501070_0070682_970_1596 208
31 3300049590 Ga0501074_0516475 Ga0501074_0516475_180_806 208
32 3300049822 Ga0501035_0212473 Ga0501035_0212473_43_669 208
33 3300049823 Ga0501044_0144926 Ga0501044_0144926_677_1318 208
34 3300049823 Ga0501044_0764761 Ga0501044_0764761_19_645 208
35 3300050508 nmdc:mga09592_580670_c1 nmdc:mga09592_580670_c1_287_934 208
36 3300050514 nmdc:mga08x19_218154_c1 nmdc:mga08x19_218154_c1_361_993 208
37 3300005471 Ga0070698_100000489 Ga0070698_10000048939 209
38 3300005545 Ga0070695_100268790 Ga0070695_1002687902 209
39 3300005330 Ga0070690_100012344 Ga0070690_1000123443 210
40 3300005334 Ga0068869_100107547 Ga0068869_1001075472 210
41 3300005337 Ga0070682_100302984 Ga0070682_1003029842 210
42 3300005340 Ga0070689_100033306 Ga0070689_1000333062 210
43 3300005340 Ga0070689_100361595 Ga0070689_1003615951 210
44 3300005365 Ga0070688_100178005 Ga0070688_1001780051 210
45 3300005367 Ga0070667_100311805 Ga0070667_1003118052 210
46 3300005445 Ga0070708_100264167 Ga0070708_1002641671 210
47 3300005456 Ga0070678_100015261 Ga0070678_1000152612 210
48 3300005458 Ga0070681_10100796 Ga0070681_101007962 210
49 3300005458 Ga0070681_10579523 Ga0070681_105795232 210
50 3300005530 Ga0070679_100097855 Ga0070679_1000978552 210
51 3300005614 Ga0068856_100033864 Ga0068856_1000338646 210
52 3300005618 Ga0068864_100079514 Ga0068864_1000795143 210
53 3300005841 Ga0068863_100740189 Ga0068863_1007401891 210
54 3300006028 Ga0070717_10012257 Ga0070717_100122577 210
55 3300006028 Ga0070717_10384706 Ga0070717_103847061 210
56 3300006871 Ga0075434_100158560 Ga0075434_1001585602 210
57 3300006881 Ga0068865_100017385 Ga0068865_1000173855 210
58 3300006914 Ga0075436_100225934 Ga0075436_1002259342 210
59 3300007076 Ga0075435_100563808 Ga0075435_1005638082 210
60 3300009098 Ga0105245_10000011 Ga0105245_10000011166 210
61 3300009176 Ga0105242_10355137 Ga0105242_103551372 210
62 3300009545 Ga0105237_10461339 Ga0105237_104613392 210
63 3300009553 Ga0105249_10030565 Ga0105249_100305653 210
64 3300009553 Ga0105249_10084489 Ga0105249_100844893 210
65 3300010375 Ga0105239_10200035 Ga0105239_102000352 210
66 3300013297 Ga0157378_10385826 Ga0157378_103858261 210
67 3300014325 Ga0163163_10500382 Ga0163163_105003822 210
68 3300014325 Ga0163163_11386286 Ga0163163_113862861 210
69 3300014969 Ga0157376_10009401 Ga0157376_100094012 210
70 3300014969 Ga0157376_11321123 Ga0157376_113211231 210
71 3300025912 Ga0207707_10395259 Ga0207707_103952592 210
72 3300025921 Ga0207652_10090400 Ga0207652_100904002 210
73 3300025921 Ga0207652_10772193 Ga0207652_107721931 210
74 3300025927 Ga0207687_10000016 Ga0207687_10000016104 210
75 3300025936 Ga0207670_10013995 Ga0207670_100139952 210
76 3300025942 Ga0207689_10114536 Ga0207689_101145362 210
77 3300025961 Ga0207712_10116127 Ga0207712_101161271 210
78 3300025972 Ga0207668_10763257 Ga0207668_107632571 210
79 3300026078 Ga0207702_10262680 Ga0207702_102626801 210
80 3300026088 Ga0207641_10751969 Ga0207641_107519691 210
81 3300026118 Ga0207675_100106897 Ga0207675_1001068972 210
82 3300026121 Ga0207683_10014220 Ga0207683_100142202 210
83 3300028786 Ga0307517_10068436 Ga0307517_100684363 210
84 3300028800 Ga0265338_10043507 Ga0265338_100435075 210
85 3300031238 Ga0265332_10020594 Ga0265332_100205942 210
86 3300031507 Ga0307509_10001723 Ga0307509_1000172336 210
87 3300031616 Ga0307508_10127840 Ga0307508_101278402 210
88 3300031901 Ga0307406_10128373 Ga0307406_101283732 210
89 3300032126 Ga0307415_100222448 Ga0307415_1002224482 210
90 3300035113 Ga0373936_0000017 Ga0373936_0000017_79774_80406 210
91 3300035115 Ga0373941_0231583 Ga0373941_0231583_13_645 210
92 3300035241 Ga0373961_0000217 Ga0373961_0000217_26105_26737 210
93 3300035724 Ga0373933_0529277 Ga0373933_0529277_13_645 210
94 3300037471 Ga0395905_0504754 Ga0395905_0504754_230_862 210
95 3300047472 Ga0495686_0014716 Ga0495686_0014716_3645_4277 210
96 3300047472 Ga0495686_0212018 Ga0495686_0212018_106_738 210
97 3300048907 Ga0496104_0613116 Ga0496104_0613116_59_691 210
98 3300049583 Ga0501067_0158541 Ga0501067_0158541_311_946 210
99 3300049585 Ga0501069_0007164 Ga0501069_0007164_840_1475 210
100 3300049586 Ga0501070_0155333 Ga0501070_0155333_575_1210 210
101 3300049588 Ga0501072_0504316 Ga0501072_0504316_23_658 210
102 3300049589 Ga0501073_0262110 Ga0501073_0262110_304_939 210
103 3300049656 Ga0501209_035180 Ga0501209_035180_532_1179 210
104 3300049660 Ga0501216_001418 Ga0501216_001418_418_1065 210
105 3300049667 Ga0501230_005004 Ga0501230_005004_123_770 210
106 3300049742 Ga0501080_0068142 Ga0501080_0068142_2507_3142 210
107 3300049744 Ga0501083_0093655 Ga0501083_0093655_847_1482 210
108 3300053080 Ga0500635_0041633 Ga0500635_0041633_675_1307 210
109 3300053091 Ga0500647_0044618 Ga0500647_0044618_631_1263 210
110 3300053094 Ga0500566_0001005 Ga0500566_0001005_3182_3814 210
111 3300053094 Ga0500566_0004836 Ga0500566_0004836_2510_3142 210
112 3300053095 Ga0500640_005013 Ga0500640_005013_1037_1669 210
113 3300053102 Ga0500554_000449 Ga0500554_000449_2687_3319 210
114 3300053104 Ga0500556_0152141 Ga0500556_0152141_161_793 210
115 3300053111 Ga0500572_005755 Ga0500572_005755_1352_1984 210
116 3300053119 Ga0500595_000074 Ga0500595_000074_15706_16338 210
117 3300053123 Ga0500614_010780 Ga0500614_010780_360_992 210
118 3300053136 Ga0500559_0012281 Ga0500559_0012281_2065_2697 210
119 3300053138 Ga0500564_096531 Ga0500564_096531_646_1278 210
120 3300053139 Ga0500568_0006488 Ga0500568_0006488_36_668 210
121 3300053144 Ga0500585_020576 Ga0500585_020576_615_1247 210
122 3300053150 Ga0500603_007876 Ga0500603_007876_795_1427 210
123 3300053737 Ga0500601_007708 Ga0500601_007708_276_908 210
124 3300005719 Ga0068861_100733572 Ga0068861_1007335722 213
125 3300006880 Ga0075429_100041888 Ga0075429_1000418882 213
126 3300026088 Ga0207641_10140532 Ga0207641_101405321 213
127 3300026118 Ga0207675_100053433 Ga0207675_1000534332 213
128 3300028381 Ga0268264_10224196 Ga0268264_102241962 213
129 3300050508 nmdc:mga09592_56828_c1 nmdc:mga09592_56828_c1_2254_2895 213
130 3300005458 Ga0070681_10299185 Ga0070681_102991851 215
131 3300028380 Ga0268265_10140459 Ga0268265_101404591 216
132 3300030521 Ga0307511_10127249 Ga0307511_101272492 216
133 3300031456 Ga0307513_10001148 Ga0307513_100011485 216
134 3300031507 Ga0307509_10004133 Ga0307509_100041338 216
135 3300035090 Ga0373949_0000813 Ga0373949_0000813_1023_1673 216
136 3300035119 Ga0373956_0038598 Ga0373956_0038598_203_853 216
137 3300046557 Ga0495622_0060641 Ga0495622_0060641_1017_1667 216
138 3300053094 Ga0500566_0130765 Ga0500566_0130765_367_1017 216
139 3300053120 Ga0500597_055044 Ga0500597_055044_719_1369 216
140 3300053130 Ga0500642_0044148 Ga0500642_0044148_898_1572 216
141 3300053159 Ga0500630_025117 Ga0500630_025117_1572_2222 216
142 3300053163 Ga0500639_013887 Ga0500639_013887_1964_2614 216
143 3300053177 Ga0500636_0120943 Ga0500636_0120943_706_1356 216
144 3300053178 Ga0500637_0066282 Ga0500637_0066282_751_1401 216
145 3300053735 Ga0500596_007924 Ga0500596_007924_551_1201 216
146 3300005329 Ga0070683_100752524 Ga0070683_1007525241 222
147 3300005334 Ga0068869_100350168 Ga0068869_1003501682 222
148 3300005841 Ga0068863_100158254 Ga0068863_1001582543 222
149 3300025927 Ga0207687_10030838 Ga0207687_100308383 222
150 3300025942 Ga0207689_10276805 Ga0207689_102768052 222
151 3300025944 Ga0207661_10829749 Ga0207661_108297491 222
152 3300031507 Ga0307509_10221558 Ga0307509_102215582 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

100

202

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cnr-assembly1.cif.gz_A crystal structure of pilz (xac1133) from xanthomonas axonopodis pv citri 0.8813 19 99
3dsg-assembly2.cif.gz_B xc1028 from xanthomonas campestris adopts a pilz domain-like structure yet with trivial c-di-gmp binding activity 0.8581 17 99
3dsg-assembly1.cif.gz_A xc1028 from xanthomonas campestris adopts a pilz domain-like structure yet with trivial c-di-gmp binding activity 0.8505 21 99
4fou-assembly1.cif.gz_C structure of the pilz-fimx(eal domain)-c-di-gmp complex responsible for the regulation of bacterial type iv pilus biogenesis 0.8349 17 101
3dsg-assembly3.cif.gz_C xc1028 from xanthomonas campestris adopts a pilz domain-like structure yet with trivial c-di-gmp binding activity 0.8247 17 96
ID Description Score Start End Superfamily
3dsgA00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7889 38 99 2.40.10.220
4xrnD00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7216 105 205 2.40.10.220
af_P37653_690_796_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6974 105 203 2.40.10.220
4i86B00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6908 110 208 2.40.10.220
4xrnD00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6882 105 205 2.40.10.220
ID Description Score Start End GO Terms
AF-A0A3N5GZW5-F1-model_v4 TIGR02266 family protein 0.8899 111 211 GO:0035438
AF-A7HAG9-F1-model_v4 Type IV pilus assembly PilZ 0.8895 105 213 GO:0035438
AF-A0A1Q3H9P6-F1-model_v4 Response regulator 0.8665 105 210 GO:0000160
GO:0035438
AF-A0A661J2F1-F1-model_v4 PilZ domain-containing protein 0.8648 105 193 GO:0035438
AF-A0A7C5RZK6-F1-model_v4 Response regulator 0.8581 107 202 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
GO:0035438

Feature Viewer

pLDDT pTM Quality
81.13 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map