F212528

General Info

Members Datasets Scaffolds Average Seq Length
151 93 303 164

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0392366|Ga0495631_0392366_16_567
Length 183
Sequence MMTTTTAMPTLARHATIATPPGPFTVIVGPDDDGRDVVLASGWTADIADLLPVIHPTLRPAESELVDDLPVLDVVEKFFAGDVRVIDDVVVRQRSGPFLQEAWEVLRTVPAGHPDTYASFAARCGRPAAVRAAANXXXXNAAALFVPCHRVLGSSGGLGGFRWGTPVKRWLLDHEAEHAPVPA

Samples

Sample ID Description Type Environment
1 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
46 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
71 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
72 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
73 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
74 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
75 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
82 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
87 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
88 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
89 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
90 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
91 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
92 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
93 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0.66
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 3.31
Rhizosphere 86.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495631_0392366 3300046518 Bacteria 591
2 rootH1_10058394 3300003316 Bacteria 1323
3 rootH1_10058394 3300003323 Bacteria 7744
4 rootL2_10118810 3300003322 Bacteria 2087
5 Ga0068869_101056880 3300005334 Bacteria 709
6 Ga0070680_100955266 3300005336 Bacteria 740
7 Ga0070682_100815124 3300005337 Bacteria 759
8 Ga0068868_101351345 3300005338 Bacteria 663
9 Ga0070710_10549570 3300005437 Bacteria 797
10 Ga0070679_100264009 3300005530 Bacteria 1677
11 Ga0070684_100535449 3300005535 Bacteria 1086
12 Ga0068857_101363888 3300005577 Bacteria 689
13 Ga0068854_100447661 3300005578 Bacteria 1078
14 Ga0068862_100258873 3300005844 Bacteria 1588
15 Ga0081539_10002964 3300005985 Bacteria 22292
16 Ga0081539_10038709 3300005985 Bacteria 2822
17 Ga0075428_100522893 3300006844 Bacteria 1269
18 Ga0075431_100232258 3300006847 Bacteria 1879
19 Ga0111539_10166199 3300009094 Bacteria 2579
20 Ga0111539_10443072 3300009094 Bacteria 1512
21 Ga0114129_10015423 3300009147 Bacteria 10871
22 Ga0105238_10452762 3300009551 Bacteria 1280
23 Ga0157369_10407755 3300013105 Bacteria 1410
24 Ga0157372_11099048 3300013307 Bacteria 920
25 Ga0163163_11452629 3300014325 Bacteria 747
26 Ga0206353_11957023 3300020082 Bacteria 1162
27 Ga0207705_10325128 3300025909 Bacteria 1182
28 Ga0207660_10660124 3300025917 Bacteria 853
29 Ga0207652_10365407 3300025921 Bacteria 1302
30 Ga0207664_10742362 3300025929 Bacteria 883
31 Ga0207686_10477165 3300025934 Bacteria 964
32 Ga0207691_10242618 3300025940 Bacteria 1557
33 Ga0207689_10351268 3300025942 Bacteria 1226
34 Ga0207640_10314374 3300025981 Bacteria 1244
35 Ga0207703_10676172 3300026035 Bacteria 981
36 Ga0207639_10554427 3300026041 Bacteria 1055
37 Ga0207639_11588400 3300026041 Bacteria 614
38 Ga0207702_10903375 3300026078 Bacteria 875
39 Ga0207674_10544671 3300026116 Bacteria 1121
40 Ga0207698_10364107 3300026142 Bacteria 1370
41 Ga0207698_10992811 3300026142 Bacteria 850
42 Ga0307517_10071897 3300028786 Bacteria 3093
43 Ga0307517_10172493 3300028786 Bacteria 1418
44 Ga0307515_10002732 3300028794 Bacteria 37745
45 Ga0307515_10050631 3300028794 Bacteria 6214
46 Ga0307512_10071597 3300030522 Bacteria 2571
47 Ga0307512_10087185 3300030522 Bacteria 2199
48 Ga0307513_10053677 3300031456 Bacteria 4329
49 Ga0307508_10596416 3300031616 Bacteria 706
50 Ga0307516_10120074 3300031730 Bacteria 2420
51 Ga0307405_10081544 3300031731 Bacteria 2115
52 Ga0307405_10410211 3300031731 Bacteria 1063
53 Ga0307405_10822193 3300031731 Bacteria 780
54 Ga0307413_10048596 3300031824 Bacteria 2537
55 Ga0307413_11077780 3300031824 Bacteria 693
56 Ga0307413_11203042 3300031824 Bacteria 659
57 Ga0307518_10134795 3300031838 Bacteria 1731
58 Ga0307410_10131795 3300031852 Bacteria 1837
59 Ga0307410_10292417 3300031852 Bacteria 1282
60 Ga0307410_10436508 3300031852 Bacteria 1065
61 Ga0307410_10694590 3300031852 Bacteria 857
62 Ga0307406_10102890 3300031901 Bacteria 1949
63 Ga0307406_10129158 3300031901 Bacteria 1771
64 Ga0307406_10357729 3300031901 Bacteria 1143
65 Ga0307406_10878716 3300031901 Bacteria 762
66 Ga0307406_10970204 3300031901 Bacteria 727
67 Ga0307407_10007211 3300031903 Bacteria 5018
68 Ga0307407_10041566 3300031903 Bacteria 2572
69 Ga0307407_10084072 3300031903 Bacteria 1932
70 Ga0307407_10290632 3300031903 Bacteria 1136
71 Ga0307407_10338277 3300031903 Bacteria 1062
72 Ga0307407_10669076 3300031903 Bacteria 779
73 Ga0307407_10883638 3300031903 Bacteria 685
74 Ga0307407_10959223 3300031903 Bacteria 659
75 Ga0307407_11193784 3300031903 Bacteria 594
76 Ga0307412_11429501 3300031911 Bacteria 627
77 Ga0307409_100020059 3300031995 Bacteria 4545
78 Ga0307409_100045961 3300031995 Bacteria 3301
79 Ga0307409_100078424 3300031995 Bacteria 2657
80 Ga0307409_100091902 3300031995 Bacteria 2489
81 Ga0307409_100124097 3300031995 Bacteria 2193
82 Ga0307409_100436266 3300031995 Bacteria 1261
83 Ga0307409_101204682 3300031995 Bacteria 781
84 Ga0307416_100093744 3300032002 Bacteria 2587
85 Ga0307416_100103507 3300032002 Bacteria 2486
86 Ga0307416_100118944 3300032002 Bacteria 2349
87 Ga0307416_100659921 3300032002 Bacteria 1131
88 Ga0307416_102693322 3300032002 Bacteria 594
89 Ga0307414_10134058 3300032004 Bacteria 1928
90 Ga0307411_10062261 3300032005 Bacteria 2488
91 Ga0307411_10991959 3300032005 Bacteria 751
92 Ga0307415_100511996 3300032126 Bacteria 1051
93 Ga0307415_100676626 3300032126 Bacteria 928
94 Ga0307415_100695473 3300032126 Bacteria 917
95 Ga0307415_101022901 3300032126 Bacteria 769
96 Ga0395899_0186016 3300037312 Bacteria 1456
97 Ga0395900_0018618 3300037418 Bacteria 7082
98 Ga0395900_0028236 3300037418 Bacteria 5747
99 Ga0395900_0234506 3300037418 Bacteria 1844
100 Ga0395898_0045467 3300037466 Bacteria 4316
101 Ga0395898_0075623 3300037466 Bacteria 3253
102 Ga0395898_0157794 3300037466 Bacteria 2170
103 Ga0395901_0015286 3300038443 Bacteria 7810
104 Ga0395901_0043254 3300038443 Bacteria 4673
105 Ga0395901_0395589 3300038443 Bacteria 1420
106 Ga0466972_0334801 3300044658 Bacteria 708
107 Ga0466965_0029212 3300044683 Bacteria 2682
108 Ga0466965_0130676 3300044683 Bacteria 1302
109 Ga0466965_0499117 3300044683 Bacteria 682
110 Ga0466961_0072774 3300044693 Bacteria 2180
111 Ga0466961_0206860 3300044693 Bacteria 1212
112 Ga0466964_0327739 3300044706 Bacteria 780
113 Ga0466971_0118779 3300044719 Bacteria 1223
114 Ga0466970_0204280 3300044765 Bacteria 1100
115 Ga0466957_0289348 3300044842 Bacteria 1098
116 Ga0466957_0512604 3300044842 Bacteria 833
117 Ga0466960_0030987 3300044901 Bacteria 2465
118 Ga0466960_0172906 3300044901 Bacteria 1167
119 Ga0466960_0175556 3300044901 Bacteria 1159
120 Ga0466960_0188754 3300044901 Bacteria 1121
121 Ga0466959_0720976 3300045049 Bacteria 668
122 Ga0466958_0367097 3300045836 Bacteria 927
123 Ga0466967_0021824 3300045976 Bacteria 5210
124 Ga0466967_0100693 3300045976 Bacteria 2640
125 Ga0466967_0338675 3300045976 Bacteria 1454
126 Ga0466967_0588724 3300045976 Bacteria 1097
127 Ga0466967_0713838 3300045976 Bacteria 993
128 Ga0496100_0229754 3300048903 Bacteria 1365
129 Ga0496102_0309481 3300048905 Bacteria 1489
130 Ga0496108_0934268 3300048911 Bacteria 743
131 Ga0496110_0089061 3300048913 Bacteria 2758
132 Ga0496111_0734835 3300048914 Bacteria 717
133 Ga0501033_0979038 3300049570 Bacteria 566
134 Ga0501034_1085980 3300049571 Bacteria 682
135 Ga0501042_0316974 3300049578 Bacteria 1127
136 Ga0501043_0100551 3300049579 Bacteria 2273
137 Ga0501046_0561468 3300049580 Bacteria 813
138 Ga0501047_1053847 3300049581 Bacteria 626
139 Ga0501074_0175410 3300049590 Bacteria 1529
140 Ga0501035_0498152 3300049822 Bacteria 1003
141 Ga0501044_0571860 3300049823 Bacteria 1025
142 nmdc:mga05p37_30211_c1 3300050507 Bacteria 6611
143 nmdc:mga09592_218603_c1 3300050508 Bacteria 1651
144 nmdc:mga08y16_273442_c1 3300050511 Bacteria 1743
145 Ga0500568_0002424 3300053139 Bacteria 10987
146 Ga0500600_0028122 3300053149 Bacteria 3328
147 Ga0466962_0105783 3300061719 Bacteria 1353
148 Ga0466962_0284456 3300061719 Bacteria 816
149 2623500437 2622736605 Bacteria 4992138
150 2753035484 2751185725 Bacteria 5740550
151 2753326490 2751185792 Bacteria 5739090
152 2795791619 2795385472 Bacteria 6627535
153 Ga0495631_0392366
154 rootH1_10058394
155 rootL2_10118810
156 Ga0068869_101056880
157 Ga0070680_100955266
158 Ga0070682_100815124
159 Ga0068868_101351345
160 Ga0070710_10549570
161 Ga0070679_100264009
162 Ga0070684_100535449
163 Ga0068857_101363888
164 Ga0068854_100447661
165 Ga0068862_100258873
166 Ga0081539_10002964
167 Ga0081539_10038709
168 Ga0075428_100522893
169 Ga0075431_100232258
170 Ga0111539_10166199
171 Ga0111539_10443072
172 Ga0114129_10015423
173 Ga0105238_10452762
174 Ga0157369_10407755
175 Ga0157372_11099048
176 Ga0163163_11452629
177 Ga0206353_11957023
178 Ga0207705_10325128
179 Ga0207660_10660124
180 Ga0207652_10365407
181 Ga0207664_10742362
182 Ga0207686_10477165
183 Ga0207691_10242618
184 Ga0207689_10351268
185 Ga0207640_10314374
186 Ga0207703_10676172
187 Ga0207639_10554427
188 Ga0207639_11588400
189 Ga0207702_10903375
190 Ga0207674_10544671
191 Ga0207698_10364107
192 Ga0207698_10992811
193 Ga0307517_10071897
194 Ga0307517_10172493
195 Ga0307515_10002732
196 Ga0307515_10050631
197 Ga0307512_10071597
198 Ga0307512_10087185
199 Ga0307513_10053677
200 Ga0307508_10596416
201 Ga0307516_10120074
202 Ga0307405_10081544
203 Ga0307405_10410211
204 Ga0307405_10822193
205 Ga0307413_10048596
206 Ga0307413_11077780
207 Ga0307413_11203042
208 Ga0307518_10134795
209 Ga0307410_10131795
210 Ga0307410_10292417
211 Ga0307410_10436508
212 Ga0307410_10694590
213 Ga0307406_10102890
214 Ga0307406_10129158
215 Ga0307406_10357729
216 Ga0307406_10878716
217 Ga0307406_10970204
218 Ga0307407_10007211
219 Ga0307407_10041566
220 Ga0307407_10084072
221 Ga0307407_10290632
222 Ga0307407_10338277
223 Ga0307407_10669076
224 Ga0307407_10883638
225 Ga0307407_10959223
226 Ga0307407_11193784
227 Ga0307412_11429501
228 Ga0307409_100020059
229 Ga0307409_100045961
230 Ga0307409_100078424
231 Ga0307409_100091902
232 Ga0307409_100124097
233 Ga0307409_100436266
234 Ga0307409_101204682
235 Ga0307416_100093744
236 Ga0307416_100103507
237 Ga0307416_100118944
238 Ga0307416_100659921
239 Ga0307416_102693322
240 Ga0307414_10134058
241 Ga0307411_10062261
242 Ga0307411_10991959
243 Ga0307415_100511996
244 Ga0307415_100676626
245 Ga0307415_100695473
246 Ga0307415_101022901
247 Ga0395899_0186016
248 Ga0395900_0018618
249 Ga0395900_0028236
250 Ga0395900_0234506
251 Ga0395898_0045467
252 Ga0395898_0075623
253 Ga0395898_0157794
254 Ga0395901_0015286
255 Ga0395901_0043254
256 Ga0395901_0395589
257 Ga0466972_0334801
258 Ga0466965_0029212
259 Ga0466965_0130676
260 Ga0466965_0499117
261 Ga0466961_0072774
262 Ga0466961_0206860
263 Ga0466964_0327739
264 Ga0466971_0118779
265 Ga0466970_0204280
266 Ga0466957_0289348
267 Ga0466957_0512604
268 Ga0466960_0030987
269 Ga0466960_0172906
270 Ga0466960_0175556
271 Ga0466960_0188754
272 Ga0466959_0720976
273 Ga0466958_0367097
274 Ga0466967_0021824
275 Ga0466967_0100693
276 Ga0466967_0338675
277 Ga0466967_0588724
278 Ga0466967_0713838
279 Ga0496100_0229754
280 Ga0496102_0309481
281 Ga0496108_0934268
282 Ga0496110_0089061
283 Ga0496111_0734835
284 Ga0501033_0979038
285 Ga0501034_1085980
286 Ga0501042_0316974
287 Ga0501043_0100551
288 Ga0501046_0561468
289 Ga0501047_1053847
290 Ga0501074_0175410
291 Ga0501035_0498152
292 Ga0501044_0571860
293 nmdc:mga05p37_30211_c1
294 nmdc:mga09592_218603_c1
295 nmdc:mga08y16_273442_c1
296 Ga0500568_0002424
297 Ga0500600_0028122
298 Ga0466962_0105783
299 Ga0466962_0284456
300 2623500437
301 2753035484
302 2753326490
303 2795791619

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

97

177

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wx9-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.8999 3 164
4enn-assembly1.cif.gz_A crystal structure of s. pombe atl1 in complex with damaged dna containing o6-carboxymethylguanine 0.884 85 162
3ezw-assembly1.cif.gz_B crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices 0.8805 2 28
4wx9-assembly1.cif.gz_C-4 crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.8744 3 164
7dqr-assembly1.cif.gz_A crystal structure of sulfurisphaera tokodaii methylated o6-methylguanine methyltransferase 0.8645 1 162
ID Description Score Start End Superfamily
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9612 81 165 1.10.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9563 80 163 1.10.10.10
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9503 81 165 1.10.10.10
af_O76339_109_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9433 81 165 1.10.10.10
af_O76339_109_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9327 81 165 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A317JT22-F1-model_v4 Methylated-DNA--protein-cysteine methyltransferase 0.9947 2 164 GO:0003908
GO:0006281
GO:0032259
AF-A0A1C6V941-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase 0.9946 2 163 GO:0003908
GO:0006281
GO:0032259
AF-A0A3D9ZIH7-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase 0.9946 3 163 GO:0003908
GO:0006281
GO:0032259
AF-A0A4P6EWD6-F1-model_v4 Methylated-DNA--[protein]-cysteine S-methyltransferase 0.993 56 164 GO:0003908
GO:0006281
GO:0032259
AF-A0A2W4J0T5-F1-model_v4 Methylated-DNA--protein-cysteine methyltransferase 0.9921 18 164 GO:0003908
GO:0006281
GO:0032259

Map