F212386

General Info

Members Datasets Scaffolds Average Seq Length
151 101 150 500

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0008027|Ga0451576_0008027_4790_6598
Length 597
Sequence LSRIVPEYLKKKPADIASPPSPGGAASQASTPPLSVVGRNPAPAGAPVTQPEASARAATARGPRLRRSGVLLHPTSLPGPFGSGDLGASARHFVDWLATGGQGLWQVLPLGIVGPGDSPYMSPSAFAGNPLLVDLHALHEAGWLAADELVPPAAFTTPEAARQVDFAAVRAFRMDRLRSAATCFFAGASVAPAVRDPAAAPAAARLDYDRFCTRAAAWLDDAALYLALCTRHGDDLRDWPAVLRRRDPAALSEAARELAGEVDFHRFVQWSFDRQWHALRRYAHAKGIRIVGDVPIFVADNGVDMWAHPELFDLDAEGRPRVIAGVPPDYFSATGQRWGNPLYRWPAHAADGYRWWIARMRHTLAQCDVVRIDHFRGFEAYWEIPGDAETAVDGRWVPGPGAALFGAIDAALAASHAPGAGVRALPVIAEDLGIITAEVTALREGLGLPGMRILQFAFDGRADNPYLPHHFERNTVVYTGTHDNDTTHGWWDGLDDDTRRRVADYAGRSLDELAADPAGHLLRLAFASVADTCIVPMQDALGLGTEARMNRPGEATGCWSWRFSWGQVGPRPAERLRELAQRYGRNAPSGGDRPDSA

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
11 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
14 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
15 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
19 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
35 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
36 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
37 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
38 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
41 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
42 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
46 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
47 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
48 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
58 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
59 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
65 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
66 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
67 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
68 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
70 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
78 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
79 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
84 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
91 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
97 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
98 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
99 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
100 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.05
Metatranscriptomes 7.28
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.62
Nodule 0
Rhizoplane 0
Rhizosphere 80.79
Stem 0
Stem Tuber 0
Unclassified 12.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100003366 3300005334 Bacteria 9763
2 Ga0070669_100023020 3300005353 Bacteria 4458
3 Ga0070674_100005274 3300005356 Bacteria 7444
4 Ga0070667_100032190 3300005367 Bacteria 4374
5 Ga0070667_100094441 3300005367 Bacteria 2577
6 Ga0070708_100047373 3300005445 Bacteria 3797
7 Ga0070708_100082645 3300005445 Bacteria 2910
8 Ga0070706_100169491 3300005467 Bacteria 2038
9 Ga0070707_100001416 3300005468 Bacteria 23536
10 Ga0070693_100037061 3300005547 Bacteria 2716
11 Ga0068870_10030104 3300005840 Bacteria 2742
12 Ga0081540_1002783 3300005983 Bacteria 14183
13 Ga0070717_10000047 3300006028 Bacteria 106225
14 Ga0070717_10094550 3300006028 Bacteria 2528
15 Ga0075366_10002454 3300006195 Bacteria 9494
16 Ga0075366_10025900 3300006195 Bacteria 3431
17 Ga0075366_10029381 3300006195 Bacteria 3229
18 Ga0075436_100035915 3300006914 Bacteria 3419
19 Ga0075435_100002603 3300007076 Bacteria 12040
20 Ga0105248_10034596 3300009177 Bacteria 5651
21 Ga0157369_10046853 3300013105 Unclassified 4697
22 Ga0157378_10036550 3300013297 Bacteria 4346
23 Ga0213873_10000003 3300021358 Bacteria 973849
24 Ga0213876_10000003 3300021384 Bacteria 973849
25 Ga0207684_10039077 3300025910 Bacteria 4026
26 Ga0207684_10140781 3300025910 Bacteria 2073
27 Ga0207695_10008276 3300025913 Bacteria 13046
28 Ga0207646_10003510 3300025922 Bacteria 17664
29 Ga0207646_10108838 3300025922 Unclassified 2487
30 Ga0207681_10024047 3300025923 Bacteria 3905
31 Ga0207700_10022989 3300025928 Bacteria 4288
32 Ga0207669_10034481 3300025937 Bacteria 2868
33 Ga0207711_10020083 3300025941 Bacteria 5568
34 Ga0207689_10046605 3300025942 Bacteria 3582
35 Ga0207651_10025199 3300025960 Bacteria 3695
36 Ga0207658_10022308 3300025986 Bacteria 4408
37 Ga0207658_10064095 3300025986 Bacteria 2756
38 Ga0207648_10025616 3300026089 Bacteria 5252
39 Ga0207676_10013213 3300026095 Bacteria 5930
40 Ga0268264_10045907 3300028381 Bacteria 3628
41 Ga0265337_1000256 3300028556 Bacteria 28806
42 Ga0265337_1017225 3300028556 Bacteria 2321
43 Ga0265326_10001546 3300028558 Bacteria 8039
44 Ga0265319_1000104 3300028563 Bacteria 65797
45 Ga0265319_1000138 3300028563 Bacteria 54541
46 Ga0265334_10000228 3300028573 Bacteria 32089
47 Ga0265318_10000696 3300028577 Bacteria 22606
48 Ga0265318_10012613 3300028577 Bacteria 3590
49 Ga0265323_10000184 3300028653 Bacteria 37673
50 Ga0265322_10000142 3300028654 Bacteria 33757
51 Ga0265336_10000179 3300028666 Bacteria 44410
52 Ga0307515_10000006 3300028794 Bacteria 725810
53 Ga0307515_10000425 3300028794 Bacteria 101790
54 Ga0307515_10000485 3300028794 Bacteria 94915
55 Ga0265338_10000897 3300028800 Bacteria 50025
56 Ga0265338_10002496 3300028800 Bacteria 27416
57 Ga0265338_10010325 3300028800 Bacteria 10966
58 Ga0265324_10000926 3300029957 Bacteria 18451
59 Ga0265324_10017707 3300029957 Bacteria 2590
60 Ga0265330_10000250 3300031235 Bacteria 40500
61 Ga0265332_10000383 3300031238 Bacteria 32380
62 Ga0265328_10002204 3300031239 Bacteria 8790
63 Ga0265320_10003582 3300031240 Bacteria 10382
64 Ga0265325_10014182 3300031241 Bacteria 4511
65 Ga0265329_10000226 3300031242 Bacteria 29914
66 Ga0265340_10000657 3300031247 Bacteria 19426
67 Ga0265339_10000436 3300031249 Bacteria 32747
68 Ga0265327_10000121 3300031251 Bacteria 170192
69 Ga0265316_10001003 3300031344 Bacteria 30637
70 Ga0265316_10009537 3300031344 Bacteria 8925
71 Ga0307513_10012019 3300031456 Bacteria 10714
72 Ga0265313_10000506 3300031595 Bacteria 40924
73 Ga0307514_10000696 3300031649 Bacteria 58844
74 Ga0316575_10000808 3300031665 Bacteria 9484
75 Ga0316579_10010799 3300031691 Bacteria 3868
76 Ga0265314_10002109 3300031711 Bacteria 20907
77 Ga0265342_10001301 3300031712 Bacteria 23409
78 Ga0265342_10004679 3300031712 Bacteria 10654
79 Ga0316576_10052493 3300031727 Bacteria 2968
80 Ga0316578_10005252 3300031728 Bacteria 6251
81 Ga0316578_10010616 3300031728 Bacteria 4787
82 Ga0316578_10032328 3300031728 Bacteria 2988
83 Ga0316578_10034769 3300031728 Bacteria 2894
84 Ga0316577_10007845 3300031733 Bacteria 5699
85 Ga0316577_10044393 3300031733 Bacteria 2486
86 Ga0316583_10002324 3300032133 Bacteria 6560
87 Ga0316583_10018914 3300032133 Bacteria 2475
88 Ga0316585_10000398 3300032137 Bacteria 10053
89 Ga0316585_10010064 3300032137 Bacteria 2771
90 Ga0316580_10000097 3300032139 Bacteria 15647
91 Ga0316593_10001068 3300032168 Bacteria 5739
92 Ga0316593_10002579 3300032168 Bacteria 4335
93 Ga0316593_10003797 3300032168 Bacteria 3797
94 Ga0316593_10004061 3300032168 Bacteria 3711
95 Ga0316593_10008425 3300032168 Bacteria 2875
96 Ga0316593_10031083 3300032168 Bacteria 1737
97 Ga0307507_10020176 3300033179 Bacteria 7475
98 Ga0316588_1000192 3300033528 Bacteria 6995
99 Ga0316588_1000448 3300033528 Bacteria 5533
100 Ga0316588_1000766 3300033528 Bacteria 4782
101 Ga0316596_1000139 3300033541 Bacteria 9919
102 Ga0316596_1000309 3300033541 Bacteria 7805
103 Ga0316574_0001629 3300035398 Bacteria 10786
104 Ga0316574_0003293 3300035398 Bacteria 8303
105 Ga0316574_0041689 3300035398 Bacteria 2830
106 Ga0373927_0050123 3300035695 Bacteria 2699
107 Ga0373937_0157368 3300036401 Bacteria 2130
108 Ga0316582_0010556 3300036647 Bacteria 5063
109 Ga0316582_0031105 3300036647 Bacteria 3259
110 Ga0316584_0000669 3300036712 Bacteria 18814
111 Ga0316584_0002016 3300036712 Bacteria 12701
112 Ga0316584_0006227 3300036712 Bacteria 8080
113 Ga0316584_0072999 3300036712 Bacteria 2571
114 Ga0400490_50389 3300038726 Bacteria 38482
115 Ga0400489_10435 3300039093 Bacteria 6985
116 Ga0400487_12582 3300039110 Bacteria 19879
117 Ga0400487_63658 3300039110 Bacteria 3367
118 Ga0436365_0378244 3300039437 Bacteria 177519
119 Ga0436360_0912515 3300039438 Bacteria 2326
120 Ga0436362_0835337 3300039453 Bacteria 281342
121 Ga0451839_0342341 3300041496 Bacteria 3558
122 Ga0450911_000082 3300042115 Bacteria 38325
123 Ga0451577_0000747 3300042876 Bacteria 49907
124 Ga0451577_0001496 3300042876 Bacteria 30972
125 Ga0451577_0003444 3300042876 Bacteria 17621
126 Ga0451577_0006393 3300042876 Bacteria 11760
127 Ga0453684_0002172 3300044712 Bacteria 49008
128 Ga0453684_0005975 3300044712 Bacteria 23596
129 Ga0453684_0009095 3300044712 Bacteria 17509
130 Ga0453684_0011185 3300044712 Bacteria 15107
131 Ga0451576_0000799 3300045051 Bacteria 61576
132 Ga0451576_0003890 3300045051 Bacteria 19977
133 Ga0451576_0008027 3300045051 Bacteria 12461
134 Ga0495602_0114361 3300048088 Bacteria 2185
135 Ga0496121_0001088 3300048924 Bacteria 48017
136 Ga0496124_0009279 3300048927 Bacteria 10146
137 Ga0496125_0010138 3300048928 Bacteria 9554
138 Ga0496125_0013591 3300048928 Bacteria 7994
139 Ga0496126_0042061 3300048929 Bacteria 4223
140 Ga0501080_0002720 3300049742 Bacteria 15500
141 nmdc:mga0k408_43470_c1 3300050493 Bacteria 2589
142 nmdc:mga0k408_4355_c1 3300050493 Bacteria 7514
143 nmdc:mga0k408_9490_c1 3300050493 Bacteria 5247
144 nmdc:mga0rr50_75_c1 3300050513 Bacteria 56801
145 nmdc:mga08x19_2172_c1 3300050514 Bacteria 11980
146 Ga0495655_0000653 3300053083 Bacteria 5607
147 Ga0500593_030925 3300053117 Bacteria 2393
148 Ga0500595_016579 3300053119 Bacteria 2740
149 Ga0500564_011742 3300053138 Bacteria 3874
150 Ga0500616_0013662 3300053153 Bacteria 4703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028556 Ga0265337_1017225 Ga0265337_10172251 439
2 3300033179 Ga0307507_10020176 Ga0307507_100201763 452
3 3300036712 Ga0316584_0006227 Ga0316584_0006227_4473_5843 453
4 3300048928 Ga0496125_0010138 Ga0496125_0010138_5513_7015 454
5 3300006195 Ga0075366_10002454 Ga0075366_100024547 459
6 3300050493 nmdc:mga0k408_9490_c1 nmdc:mga0k408_9490_c1_653_2206 459
7 3300048924 Ga0496121_0001088 Ga0496121_0001088_25297_26799 467
8 3300028794 Ga0307515_10000485 Ga0307515_1000048538 472
9 3300031649 Ga0307514_10000696 Ga0307514_1000069643 472
10 3300031456 Ga0307513_10012019 Ga0307513_100120193 473
11 3300005445 Ga0070708_100047373 Ga0070708_1000473732 475
12 3300006914 Ga0075436_100035915 Ga0075436_1000359154 477
13 3300007076 Ga0075435_100002603 Ga0075435_10000260310 477
14 3300028556 Ga0265337_1000256 Ga0265337_100025621 477
15 3300028563 Ga0265319_1000104 Ga0265319_100010446 477
16 3300028573 Ga0265334_10000228 Ga0265334_1000022825 477
17 3300028577 Ga0265318_10000696 Ga0265318_100006962 477
18 3300028666 Ga0265336_10000179 Ga0265336_1000017933 477
19 3300028800 Ga0265338_10002496 Ga0265338_100024966 477
20 3300031241 Ga0265325_10014182 Ga0265325_100141823 477
21 3300031247 Ga0265340_10000657 Ga0265340_100006576 477
22 3300031344 Ga0265316_10009537 Ga0265316_100095372 477
23 3300031595 Ga0265313_10000506 Ga0265313_1000050621 477
24 3300031712 Ga0265342_10004679 Ga0265342_100046792 477
25 3300050513 nmdc:mga0rr50_75_c1 nmdc:mga0rr50_75_c1_52249_53682 477
26 3300050514 nmdc:mga08x19_2172_c1 nmdc:mga08x19_2172_c1_1139_2572 477
27 3300053119 Ga0500595_016579 Ga0500595_016579_316_1788 477
28 3300032168 Ga0316593_10008425 Ga0316593_100084252 478
29 3300006028 Ga0070717_10094550 Ga0070717_100945502 479
30 3300044712 Ga0453684_0011185 Ga0453684_0011185_9734_11215 479
31 3300005356 Ga0070674_100005274 Ga0070674_1000052743 480
32 3300025922 Ga0207646_10108838 Ga0207646_101088381 480
33 3300025937 Ga0207669_10034481 Ga0207669_100344812 480
34 3300026089 Ga0207648_10025616 Ga0207648_100256163 480
35 3300044712 Ga0453684_0009095 Ga0453684_0009095_14474_16027 480
36 3300049742 Ga0501080_0002720 Ga0501080_0002720_6756_8207 480
37 3300031733 Ga0316577_10044393 Ga0316577_100443932 482
38 3300035398 Ga0316574_0001629 Ga0316574_0001629_788_2248 482
39 3300036647 Ga0316582_0031105 Ga0316582_0031105_1490_2950 482
40 3300005547 Ga0070693_100037061 Ga0070693_1000370612 483
41 3300031728 Ga0316578_10032328 Ga0316578_100323282 485
42 3300035398 Ga0316574_0003293 Ga0316574_0003293_5442_6908 485
43 3300031251 Ga0265327_10000121 Ga0265327_10000121104 486
44 3300032168 Ga0316593_10004061 Ga0316593_100040613 486
45 3300035695 Ga0373927_0050123 Ga0373927_0050123_877_2406 486
46 3300032137 Ga0316585_10010064 Ga0316585_100100642 487
47 3300033528 Ga0316588_1000448 Ga0316588_10004485 487
48 3300033528 Ga0316588_1000766 Ga0316588_10007663 487
49 3300036647 Ga0316582_0010556 Ga0316582_0010556_624_2111 487
50 3300036712 Ga0316584_0002016 Ga0316584_0002016_4551_6038 487
51 3300036712 Ga0316584_0072999 Ga0316584_0072999_831_2318 487
52 3300053083 Ga0495655_0000653 Ga0495655_0000653_3771_5234 487
53 3300028794 Ga0307515_10000425 Ga0307515_1000042522 488
54 3300042115 Ga0450911_000082 Ga0450911_000082_20449_21951 488
55 3300048927 Ga0496124_0009279 Ga0496124_0009279_6153_7655 488
56 3300048929 Ga0496126_0042061 Ga0496126_0042061_1971_3473 488
57 3300053138 Ga0500564_011742 Ga0500564_011742_1933_3420 488
58 3300032168 Ga0316593_10002579 Ga0316593_100025793 490
59 3300038726 Ga0400490_50389 Ga0400490_50389_32416_33918 490
60 3300039093 Ga0400489_10435 Ga0400489_10435_2903_4405 490
61 3300044712 Ga0453684_0005975 Ga0453684_0005975_12195_13682 490
62 3300006195 Ga0075366_10025900 Ga0075366_100259003 491
63 3300032133 Ga0316583_10002324 Ga0316583_100023241 491
64 3300032168 Ga0316593_10001068 Ga0316593_100010683 491
65 3300039110 Ga0400487_63658 Ga0400487_63658_163_1659 491
66 3300042876 Ga0451577_0006393 Ga0451577_0006393_107_1606 491
67 3300050493 nmdc:mga0k408_4355_c1 nmdc:mga0k408_4355_c1_4316_5869 491
68 iso_pu_bacteria 2524023250 2524612291 492
69 3300025910 Ga0207684_10039077 Ga0207684_100390772 493
70 3300025910 Ga0207684_10140781 Ga0207684_101407812 493
71 3300025922 Ga0207646_10003510 Ga0207646_1000351013 493
72 3300053117 Ga0500593_030925 Ga0500593_030925_750_2249 493
73 3300053153 Ga0500616_0013662 Ga0500616_0013662_2440_3939 493
74 3300005445 Ga0070708_100082645 Ga0070708_1000826453 494
75 3300005467 Ga0070706_100169491 Ga0070706_1001694912 494
76 3300005468 Ga0070707_100001416 Ga0070707_10000141620 494
77 3300013105 Ga0157369_10046853 Ga0157369_100468532 494
78 3300025913 Ga0207695_10008276 Ga0207695_100082767 494
79 3300028794 Ga0307515_10000006 Ga0307515_10000006369 494
80 3300031665 Ga0316575_10000808 Ga0316575_100008084 494
81 3300031691 Ga0316579_10010799 Ga0316579_100107993 494
82 3300031727 Ga0316576_10052493 Ga0316576_100524931 494
83 3300031728 Ga0316578_10005252 Ga0316578_100052523 494
84 3300031728 Ga0316578_10034769 Ga0316578_100347692 494
85 3300031733 Ga0316577_10007845 Ga0316577_100078453 494
86 3300032133 Ga0316583_10018914 Ga0316583_100189142 494
87 3300032137 Ga0316585_10000398 Ga0316585_100003984 494
88 3300032139 Ga0316580_10000097 Ga0316580_100000972 494
89 3300032168 Ga0316593_10003797 Ga0316593_100037972 494
90 3300032168 Ga0316593_10031083 Ga0316593_100310831 494
91 3300033528 Ga0316588_1000192 Ga0316588_10001924 494
92 3300033541 Ga0316596_1000139 Ga0316596_10001394 494
93 3300033541 Ga0316596_1000309 Ga0316596_10003094 494
94 3300036401 Ga0373937_0157368 Ga0373937_0157368_236_1762 494
95 3300036712 Ga0316584_0000669 Ga0316584_0000669_2179_3687 494
96 3300042876 Ga0451577_0001496 Ga0451577_0001496_6628_8142 494
97 3300045051 Ga0451576_0000799 Ga0451576_0000799_2546_4054 494
98 3300048088 Ga0495602_0114361 Ga0495602_0114361_445_1971 494
99 3300048928 Ga0496125_0013591 Ga0496125_0013591_920_2422 494
100 3300005983 Ga0081540_1002783 Ga0081540_100278312 495
101 3300031728 Ga0316578_10010616 Ga0316578_100106163 495
102 3300035398 Ga0316574_0041689 Ga0316574_0041689_170_1687 495
103 3300039438 Ga0436360_0912515 Ga0436360_0912515_191_1720 495
104 3300005367 Ga0070667_100094441 Ga0070667_1000944412 496
105 3300006028 Ga0070717_10000047 Ga0070717_1000004799 496
106 3300006195 Ga0075366_10029381 Ga0075366_100293811 496
107 3300013297 Ga0157378_10036550 Ga0157378_100365503 496
108 3300025928 Ga0207700_10022989 Ga0207700_100229892 496
109 3300025942 Ga0207689_10046605 Ga0207689_100466052 496
110 3300025986 Ga0207658_10064095 Ga0207658_100640952 496
111 3300026095 Ga0207676_10013213 Ga0207676_100132134 496
112 3300028381 Ga0268264_10045907 Ga0268264_100459072 496
113 3300028558 Ga0265326_10001546 Ga0265326_100015466 496
114 3300028563 Ga0265319_1000138 Ga0265319_100013832 496
115 3300028577 Ga0265318_10012613 Ga0265318_100126132 496
116 3300028653 Ga0265323_10000184 Ga0265323_1000018414 496
117 3300028654 Ga0265322_10000142 Ga0265322_1000014210 496
118 3300028800 Ga0265338_10000897 Ga0265338_1000089730 496
119 3300028800 Ga0265338_10010325 Ga0265338_100103252 496
120 3300029957 Ga0265324_10000926 Ga0265324_1000092611 496
121 3300029957 Ga0265324_10017707 Ga0265324_100177072 496
122 3300031235 Ga0265330_10000250 Ga0265330_1000025022 496
123 3300031238 Ga0265332_10000383 Ga0265332_1000038316 496
124 3300031239 Ga0265328_10002204 Ga0265328_100022045 496
125 3300031240 Ga0265320_10003582 Ga0265320_100035827 496
126 3300031242 Ga0265329_10000226 Ga0265329_100002267 496
127 3300031249 Ga0265339_10000436 Ga0265339_1000043613 496
128 3300031344 Ga0265316_10001003 Ga0265316_1000100312 496
129 3300031711 Ga0265314_10002109 Ga0265314_100021098 496
130 3300031712 Ga0265342_10001301 Ga0265342_100013019 496
131 3300050493 nmdc:mga0k408_43470_c1 nmdc:mga0k408_43470_c1_25_1527 496
132 3300005353 Ga0070669_100023020 Ga0070669_1000230201 497
133 3300005840 Ga0068870_10030104 Ga0068870_100301042 497
134 3300025923 Ga0207681_10024047 Ga0207681_100240472 497
135 3300025960 Ga0207651_10025199 Ga0207651_100251992 497
136 3300009177 Ga0105248_10034596 Ga0105248_100345963 499
137 3300025941 Ga0207711_10020083 Ga0207711_100200833 499
138 3300039110 Ga0400487_12582 Ga0400487_12582_5683_7380 499
139 3300041496 Ga0451839_0342341 Ga0451839_0342341_813_2312 499
140 3300042876 Ga0451577_0000747 Ga0451577_0000747_13729_15270 502
141 3300042876 Ga0451577_0003444 Ga0451577_0003444_630_2165 502
142 3300044712 Ga0453684_0002172 Ga0453684_0002172_13733_15274 502
143 3300045051 Ga0451576_0003890 Ga0451576_0003890_6509_8050 502
144 3300021358 Ga0213873_10000003 Ga0213873_10000003107 503
145 3300021384 Ga0213876_10000003 Ga0213876_10000003761 503
146 3300039437 Ga0436365_0378244 Ga0436365_0378244_166609_168129 503
147 3300039453 Ga0436362_0835337 Ga0436362_0835337_239329_240849 503
148 3300045051 Ga0451576_0008027 Ga0451576_0008027_4790_6598 504
149 3300005367 Ga0070667_100032190 Ga0070667_1000321903 505
150 3300025986 Ga0207658_10022308 Ga0207658_100223082 505
151 3300005334 Ga0068869_100003366 Ga0068869_1000033662 506

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02446

Glyco_hydro_77

4-alpha-glucanotransferase

72

569

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x1i-assembly1.cif.gz_A glycoside hydrolase family 77 4-alpha-glucanotransferase from thermus brockianus 0.9618 14 503
2owc-assembly1.cif.gz_A structure of a covalent intermediate in thermus thermophilus amylomaltase 0.9597 12 504
1fp9-assembly1.cif.gz_A structure of amylomaltase from thermus thermophilus hb8 in space group c2 0.9583 12 504
1esw-assembly1.cif.gz_A x-ray structure of acarbose bound to amylomaltase from thermus aquaticus. implications for the synthesis of large cyclic glucans 0.9582 12 504
6m6t-assembly8.cif.gz_H amylomaltase from streptococcus agalactiae in complex with acarbose 0.9578 14 503
ID Description Score Start End Superfamily
5jiwA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9569 12 504 3.20.20.80
1tz7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9499 11 505 3.20.20.80
1tz7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.948 11 505 3.20.20.80
5jiwA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9439 12 504 3.20.20.80
5cpqB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.943 12 504 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A2V7W530-F1-model_v4 4-alpha-glucanotransferase (EC 2.4.1.25) (Amylomaltase) (Disproportionating enzyme) 0.992 14 212 GO:0004134
GO:0005975
AF-A0A6P0J0A7-F1-model_v4 4-alpha-glucanotransferase (EC 2.4.1.25) (Amylomaltase) (Disproportionating enzyme) 0.9849 14 231 GO:0004134
GO:0005975
AF-A0A1B7X5N3-F1-model_v4 4-alpha-glucanotransferase (EC 2.4.1.25) (Amylomaltase) (Disproportionating enzyme) 0.9845 14 121 GO:0004134
GO:0005975
AF-M1BDK8-F1-model_v4 4-alpha-glucanotransferase (EC 2.4.1.25) (Amylomaltase) (Disproportionating enzyme) 0.9824 281 382 GO:0004134
GO:0005975
AF-A0A7C7GZY8-F1-model_v4 4-alpha-glucanotransferase (EC 2.4.1.25) (Amylomaltase) (Disproportionating enzyme) 0.9813 14 247 GO:0004134
GO:0005975

Feature Viewer

pLDDT pTM Quality
91.07 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map