F211444

General Info

Members Datasets Scaffolds Average Seq Length
151 109 149 160

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11054863|Ga0114129_110548632
Length 193
Sequence MMSAVFDCRLTNGWSMQAARDRRRRSVTLKGVSMDNMQLKQVLITKIAMLIRKPVAEVFEAFVDPDITPKFWFTKSSGRLEVGKQVQWEWEMYGISIPVTAKTIEQNKRIVIEWPGYRGATTVEWTFAPQKDGTTFVSVTETGFTGDGDELVKQVTDSTQGHSLVLAGLKALLEHDVKLNLVADRYPKGIAEH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
3 2904456579 Variovorax sp. 2002 Isolate Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
96 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
97 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
105 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
106 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
109 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.62
Nodule 0
Rhizoplane 1.32
Rhizosphere 89.4
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3290694 2162886007 Bacteria 1049
2 Ga0065714_10138450 3300005288 Bacteria 1190
3 Ga0065704_10008787 3300005289 Bacteria 2980
4 Ga0065704_10076986 3300005289 Bacteria 4897
5 Ga0065704_10194826 3300005289 Bacteria 1173
6 Ga0065704_10310953 3300005289 Unclassified 864
7 Ga0065704_10496012 3300005289 Bacteria 671
8 Ga0065707_10035417 3300005295 Bacteria 976
9 Ga0065707_10132945 3300005295 Unclassified 1889
10 Ga0070689_100229300 3300005340 Bacteria 1526
11 Ga0070674_100698934 3300005356 Unclassified 867
12 Ga0070709_10076648 3300005434 Bacteria 2172
13 Ga0070709_10994647 3300005434 Bacteria 667
14 Ga0070713_100985894 3300005436 Bacteria 813
15 Ga0070705_100058149 3300005440 Bacteria 2284
16 Ga0070698_100621036 3300005471 Unclassified 1021
17 Ga0070699_100027596 3300005518 Bacteria 4896
18 Ga0070686_100416429 3300005544 Bacteria 1025
19 Ga0070695_100245606 3300005545 Bacteria 1300
20 Ga0070695_100656089 3300005545 Bacteria 829
21 Ga0070695_101161492 3300005545 Unclassified 634
22 Ga0070704_100086974 3300005549 Bacteria 2318
23 Ga0070704_100105321 3300005549 Bacteria 2135
24 Ga0068859_100023415 3300005617 Bacteria 6197
25 Ga0068858_100005021 3300005842 Bacteria 12966
26 Ga0068860_100016999 3300005843 Bacteria 7090
27 Ga0081455_10058220 3300005937 Bacteria 3270
28 Ga0081455_10723140 3300005937 Unclassified 632
29 Ga0075365_10098822 3300006038 Bacteria 1997
30 Ga0075363_100355559 3300006048 Bacteria 856
31 Ga0070712_100478657 3300006175 Bacteria 1041
32 Ga0075362_10032682 3300006177 Bacteria 2259
33 Ga0075369_10186563 3300006186 Bacteria 955
34 Ga0075428_100981055 3300006844 Unclassified 895
35 Ga0075428_100989147 3300006844 Bacteria 891
36 Ga0075430_100565111 3300006846 Unclassified 938
37 Ga0075431_100009189 3300006847 Bacteria 9914
38 Ga0075431_100729756 3300006847 Unclassified 967
39 Ga0075431_100827859 3300006847 Unclassified 898
40 Ga0075433_10222785 3300006852 Bacteria 1675
41 Ga0075433_10943982 3300006852 Bacteria 752
42 Ga0075434_100144467 3300006871 Unclassified 2399
43 Ga0075434_100680792 3300006871 Unclassified 1046
44 Ga0075434_100818161 3300006871 Bacteria 947
45 Ga0075429_100140082 3300006880 Unclassified 2117
46 Ga0075429_100140251 3300006880 Bacteria 2116
47 Ga0097620_100023415 3300006931 Bacteria 6197
48 Ga0105244_10000002 3300009036 Bacteria 495554
49 Ga0105250_10080159 3300009092 Bacteria 1323
50 Ga0111539_10003278 3300009094 Bacteria 21398
51 Ga0105247_10004676 3300009101 Bacteria 8724
52 Ga0114129_10217002 3300009147 Unclassified 2583
53 Ga0114129_10314075 3300009147 Bacteria 2085
54 Ga0114129_10319782 3300009147 Bacteria 2063
55 Ga0114129_11054863 3300009147 Bacteria 1020
56 Ga0114129_11157325 3300009147 Bacteria 966
57 Ga0114129_11540675 3300009147 Bacteria 815
58 Ga0114129_12288446 3300009147 Bacteria 649
59 Ga0105243_11779452 3300009148 Bacteria 647
60 Ga0105241_10748697 3300009174 Unclassified 896
61 Ga0105242_10004060 3300009176 Bacteria 11374
62 Ga0105242_11550167 3300009176 Unclassified 695
63 Ga0105248_10572729 3300009177 Bacteria 1274
64 Ga0105237_10830547 3300009545 Bacteria 931
65 Ga0105249_10284568 3300009553 Bacteria 1652
66 Ga0157378_10823167 3300013297 Bacteria 955
67 Ga0163162_10245901 3300013306 Bacteria 1920
68 Ga0157375_10293514 3300013308 Bacteria 1789
69 Ga0163163_10140160 3300014325 Bacteria 2460
70 Ga0157377_10042585 3300014745 Unclassified 2522
71 Ga0157379_10288107 3300014968 Bacteria 1495
72 Ga0157376_11715081 3300014969 Bacteria 663
73 Ga0182006_1008147 3300015261 Bacteria 4754
74 Ga0182006_1058221 3300015261 Bacteria 1466
75 Ga0182007_10019955 3300015262 Bacteria 2401
76 Ga0182005_1166889 3300015265 Bacteria 648
77 Ga0209676_1053160 3300025292 Bacteria 1052
78 Ga0209051_1000673 3300025303 Bacteria 38238
79 Ga0207655_1000012 3300025728 Bacteria 640488
80 Ga0207710_10006510 3300025900 Bacteria 4980
81 Ga0207646_11109277 3300025922 Unclassified 696
82 Ga0207681_10000051 3300025923 Bacteria 114367
83 Ga0207700_10114619 3300025928 Bacteria 2175
84 Ga0207686_10072438 3300025934 Bacteria 2220
85 Ga0207670_10221748 3300025936 Bacteria 1448
86 Ga0207669_10377977 3300025937 Bacteria 1103
87 Ga0207712_10103174 3300025961 Unclassified 2125
88 Ga0207712_10957437 3300025961 Unclassified 758
89 Ga0207658_10212418 3300025986 Bacteria 1622
90 Ga0207703_10001907 3300026035 Bacteria 18489
91 Ga0207675_100235815 3300026118 Bacteria 1766
92 Ga0207428_10158731 3300027907 Archaea 1718
93 Ga0268264_10020336 3300028381 Bacteria 5425
94 Ga0316178_1021994 3300030735 Unclassified 1369
95 Ga0307408_100019286 3300031548 Bacteria 4591
96 Ga0307408_100158884 3300031548 Bacteria 1793
97 Ga0307516_10489410 3300031730 Bacteria 885
98 Ga0307405_10000586 3300031731 Bacteria 13951
99 Ga0307413_10000167 3300031824 Bacteria 18288
100 Ga0307410_10002831 3300031852 Bacteria 8524
101 Ga0307406_10004189 3300031901 Bacteria 7848
102 Ga0307412_10116944 3300031911 Bacteria 1913
103 Ga0307416_100000762 3300032002 Bacteria 16869
104 Ga0307416_100189865 3300032002 Unclassified 1936
105 Ga0307416_100969451 3300032002 Bacteria 953
106 Ga0307416_101378990 3300032002 Bacteria 811
107 Ga0307414_10082512 3300032004 Bacteria 2357
108 Ga0307414_10167625 3300032004 Bacteria 1752
109 Ga0307411_10000320 3300032005 Bacteria 15972
110 Ga0307411_10522407 3300032005 Bacteria 1008
111 Ga0307415_100143218 3300032126 Bacteria 1829
112 Ga0395900_0903024 3300037418 Bacteria 807
113 Ga0395905_1595550 3300037471 Unclassified 557
114 Ga0395901_1542553 3300038443 Unclassified 619
115 Ga0451577_0346400 3300042876 Bacteria 1348
116 Ga0453683_0290440 3300044673 Bacteria 1045
117 Ga0453684_0700207 3300044712 Unclassified 1101
118 Ga0451576_0015695 3300045051 Bacteria 8384
119 Ga0496102_0929711 3300048905 Bacteria 791
120 Ga0496103_0716370 3300048906 Bacteria 634
121 Ga0496125_0001124 3300048928 Bacteria 40871
122 Ga0496126_0023118 3300048929 Bacteria 6026
123 Ga0501257_005940 3300049686 Unclassified 2702
124 Ga0501080_0148964 3300049742 Unclassified 2164
125 Ga0501081_0925354 3300049743 Bacteria 658
126 nmdc:mga03683_27310_c1 3300050489 Bacteria 2259
127 nmdc:mga0yw44_28970_c1 3300050492 Bacteria 3191
128 nmdc:mga05p37_1195319_c1 3300050507 Unclassified 786
129 nmdc:mga05p37_365376_c1 3300050507 Unclassified 1695
130 nmdc:mga05p37_648362_c1 3300050507 Bacteria 1183
131 nmdc:mga05p37_71232_c1 3300050507 Bacteria 4276
132 nmdc:mga05p37_983534_c1 3300050507 Unclassified 899
133 nmdc:mga09592_32778_c1 3300050508 Bacteria 4331
134 nmdc:mga0qj67_189418_c1 3300050509 Bacteria 1672
135 nmdc:mga0qj67_521099_c1 3300050509 Unclassified 955
136 nmdc:mga06r32_1109942_c1 3300050510 Unclassified 740
137 nmdc:mga06r32_19128_c1 3300050510 Bacteria 6284
138 nmdc:mga06r32_559208_c1 3300050510 Bacteria 1117
139 nmdc:mga06r32_91540_c1 3300050510 Unclassified 2972
140 nmdc:mga08y16_50846_c1 3300050511 Bacteria 4337
141 nmdc:mga0n895_265691_c1 3300050512 Unclassified 1741
142 nmdc:mga0n895_365204_c1 3300050512 Unclassified 1461
143 nmdc:mga0rr50_173672_c1 3300050513 Bacteria 1215
144 nmdc:mga0rr50_456578_c1 3300050513 Bacteria 1083
145 nmdc:mga0sz30_177423_c1 3300050516 Bacteria 945
146 Ga0500616_0011357 3300053153 Bacteria 5266
147 Ga0501084_1439086 3300054114 Unclassified 577
148 Ga0590075_048436 3300059424 Bacteria 1089
149 Ga0590077_019706 3300059426 Bacteria 1430

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10994647 Ga0070709_109946471 138
2 3300005617 Ga0068859_100023415 Ga0068859_1000234154 138
3 3300005843 Ga0068860_100016999 Ga0068860_1000169994 138
4 3300006931 Ga0097620_100023415 Ga0097620_1000234155 138
5 3300009101 Ga0105247_10004676 Ga0105247_100046762 138
6 3300009177 Ga0105248_10572729 Ga0105248_105727291 138
7 3300013306 Ga0163162_10245901 Ga0163162_102459013 138
8 3300014325 Ga0163163_10140160 Ga0163163_101401602 138
9 3300025900 Ga0207710_10006510 Ga0207710_100065104 138
10 3300025986 Ga0207658_10212418 Ga0207658_102124182 138
11 3300028381 Ga0268264_10020336 Ga0268264_100203364 138
12 3300048905 Ga0496102_0929711 Ga0496102_0929711_252_743 138
13 3300048906 Ga0496103_0716370 Ga0496103_0716370_132_623 138
14 3300014968 Ga0157379_10288107 Ga0157379_102881071 140
15 3300009545 Ga0105237_10830547 Ga0105237_108305472 142
16 3300005842 Ga0068858_100005021 Ga0068858_1000050219 143
17 3300026035 Ga0207703_10001907 Ga0207703_100019074 143
18 3300048928 Ga0496125_0001124 Ga0496125_0001124_4119_4631 143
19 3300048929 Ga0496126_0023118 Ga0496126_0023118_859_1371 143
20 3300054114 Ga0501084_1439086 Ga0501084_1439086_118_564 144
21 3300005440 Ga0070705_100058149 Ga0070705_1000581493 145
22 3300005545 Ga0070695_100245606 Ga0070695_1002456062 145
23 3300009174 Ga0105241_10748697 Ga0105241_107486972 145
24 3300013297 Ga0157378_10823167 Ga0157378_108231672 145
25 3300006844 Ga0075428_100981055 Ga0075428_1009810551 153
26 3300044712 Ga0453684_0700207 Ga0453684_0700207_326_796 153
27 3300045051 Ga0451576_0015695 Ga0451576_0015695_3659_4129 153
28 3300006871 Ga0075434_100680792 Ga0075434_1006807921 154
29 3300009147 Ga0114129_11540675 Ga0114129_115406752 154
30 3300049686 Ga0501257_005940 Ga0501257_005940_512_985 154
31 3300050512 nmdc:mga0n895_365204_c1 nmdc:mga0n895_365204_c1_420_893 154
32 3300005288 Ga0065714_10138450 Ga0065714_101384502 155
33 3300005937 Ga0081455_10058220 Ga0081455_100582205 155
34 3300009036 Ga0105244_10000002 Ga0105244_10000002181 155
35 3300009147 Ga0114129_12288446 Ga0114129_122884461 155
36 3300013308 Ga0157375_10293514 Ga0157375_102935141 155
37 3300025728 Ga0207655_1000012 Ga0207655_1000012213 155
38 iso_pu_bacteria 2904449895 2904454220 155
39 iso_pu_bacteria 2904456579 2904463002 155
40 3300005434 Ga0070709_10076648 Ga0070709_100766482 156
41 3300006871 Ga0075434_100144467 Ga0075434_1001444673 156
42 3300009092 Ga0105250_10080159 Ga0105250_100801592 156
43 3300030735 Ga0316178_1021994 Ga0316178_10219942 156
44 3300032002 Ga0307416_100969451 Ga0307416_1009694512 156
45 3300037471 Ga0395905_1595550 Ga0395905_1595550_30_521 156
46 3300050507 nmdc:mga05p37_1195319_c1 nmdc:mga05p37_1195319_c1_218_697 156
47 3300050507 nmdc:mga05p37_983534_c1 nmdc:mga05p37_983534_c1_29_508 156
48 3300050509 nmdc:mga0qj67_189418_c1 nmdc:mga0qj67_189418_c1_1117_1596 156
49 3300050510 nmdc:mga06r32_1109942_c1 nmdc:mga06r32_1109942_c1_18_497 156
50 3300050512 nmdc:mga0n895_265691_c1 nmdc:mga0n895_265691_c1_415_894 156
51 3300053153 Ga0500616_0011357 Ga0500616_0011357_877_1353 156
52 3300059424 Ga0590075_048436 Ga0590075_048436_330_809 156
53 3300059426 Ga0590077_019706 Ga0590077_019706_546_1025 156
54 2162886007 SwRhRL2b_contig_3290694 SwRhRL2b_0025.00006690 157
55 3300005289 Ga0065704_10008787 Ga0065704_100087875 157
56 3300005289 Ga0065704_10076986 Ga0065704_100769866 157
57 3300005289 Ga0065704_10194826 Ga0065704_101948261 157
58 3300005289 Ga0065704_10310953 Ga0065704_103109531 157
59 3300005289 Ga0065704_10496012 Ga0065704_104960122 157
60 3300005295 Ga0065707_10035417 Ga0065707_100354172 157
61 3300005295 Ga0065707_10132945 Ga0065707_101329452 157
62 3300005340 Ga0070689_100229300 Ga0070689_1002293002 157
63 3300005356 Ga0070674_100698934 Ga0070674_1006989342 157
64 3300005436 Ga0070713_100985894 Ga0070713_1009858942 157
65 3300005471 Ga0070698_100621036 Ga0070698_1006210362 157
66 3300005518 Ga0070699_100027596 Ga0070699_1000275963 157
67 3300005544 Ga0070686_100416429 Ga0070686_1004164293 157
68 3300005545 Ga0070695_100656089 Ga0070695_1006560891 157
69 3300005545 Ga0070695_101161492 Ga0070695_1011614921 157
70 3300005549 Ga0070704_100086974 Ga0070704_1000869742 157
71 3300005549 Ga0070704_100105321 Ga0070704_1001053211 157
72 3300005937 Ga0081455_10723140 Ga0081455_107231401 157
73 3300006038 Ga0075365_10098822 Ga0075365_100988222 157
74 3300006048 Ga0075363_100355559 Ga0075363_1003555592 157
75 3300006175 Ga0070712_100478657 Ga0070712_1004786572 157
76 3300006177 Ga0075362_10032682 Ga0075362_100326821 157
77 3300006186 Ga0075369_10186563 Ga0075369_101865631 157
78 3300006844 Ga0075428_100989147 Ga0075428_1009891472 157
79 3300006846 Ga0075430_100565111 Ga0075430_1005651112 157
80 3300006847 Ga0075431_100009189 Ga0075431_1000091897 157
81 3300006847 Ga0075431_100729756 Ga0075431_1007297562 157
82 3300006847 Ga0075431_100827859 Ga0075431_1008278591 157
83 3300006852 Ga0075433_10222785 Ga0075433_102227852 157
84 3300006852 Ga0075433_10943982 Ga0075433_109439821 157
85 3300006871 Ga0075434_100818161 Ga0075434_1008181612 157
86 3300006880 Ga0075429_100140082 Ga0075429_1001400821 157
87 3300006880 Ga0075429_100140251 Ga0075429_1001402513 157
88 3300009094 Ga0111539_10003278 Ga0111539_100032785 157
89 3300009147 Ga0114129_10217002 Ga0114129_102170024 157
90 3300009147 Ga0114129_10314075 Ga0114129_103140753 157
91 3300009147 Ga0114129_10319782 Ga0114129_103197822 157
92 3300009147 Ga0114129_11054863 Ga0114129_110548632 157
93 3300009147 Ga0114129_11157325 Ga0114129_111573251 157
94 3300009148 Ga0105243_11779452 Ga0105243_117794521 157
95 3300009176 Ga0105242_10004060 Ga0105242_100040606 157
96 3300009176 Ga0105242_11550167 Ga0105242_115501671 157
97 3300009553 Ga0105249_10284568 Ga0105249_102845682 157
98 3300014745 Ga0157377_10042585 Ga0157377_100425853 157
99 3300014969 Ga0157376_11715081 Ga0157376_117150811 157
100 3300015261 Ga0182006_1008147 Ga0182006_10081475 157
101 3300015261 Ga0182006_1058221 Ga0182006_10582212 157
102 3300015262 Ga0182007_10019955 Ga0182007_100199552 157
103 3300015265 Ga0182005_1166889 Ga0182005_11668891 157
104 3300025292 Ga0209676_1053160 Ga0209676_10531602 157
105 3300025303 Ga0209051_1000673 Ga0209051_10006739 157
106 3300025922 Ga0207646_11109277 Ga0207646_111092771 157
107 3300025923 Ga0207681_10000051 Ga0207681_1000005192 157
108 3300025928 Ga0207700_10114619 Ga0207700_101146192 157
109 3300025934 Ga0207686_10072438 Ga0207686_100724382 157
110 3300025936 Ga0207670_10221748 Ga0207670_102217482 157
111 3300025937 Ga0207669_10377977 Ga0207669_103779772 157
112 3300025961 Ga0207712_10103174 Ga0207712_101031742 157
113 3300025961 Ga0207712_10957437 Ga0207712_109574372 157
114 3300026118 Ga0207675_100235815 Ga0207675_1002358152 157
115 3300027907 Ga0207428_10158731 Ga0207428_101587313 157
116 3300031548 Ga0307408_100019286 Ga0307408_1000192862 157
117 3300031548 Ga0307408_100158884 Ga0307408_1001588843 157
118 3300031730 Ga0307516_10489410 Ga0307516_104894101 157
119 3300031731 Ga0307405_10000586 Ga0307405_1000058618 157
120 3300031824 Ga0307413_10000167 Ga0307413_100001675 157
121 3300031852 Ga0307410_10002831 Ga0307410_100028315 157
122 3300031901 Ga0307406_10004189 Ga0307406_1000418912 157
123 3300031911 Ga0307412_10116944 Ga0307412_101169442 157
124 3300032002 Ga0307416_100000762 Ga0307416_10000076216 157
125 3300032002 Ga0307416_100189865 Ga0307416_1001898653 157
126 3300032002 Ga0307416_101378990 Ga0307416_1013789901 157
127 3300032004 Ga0307414_10082512 Ga0307414_100825122 157
128 3300032004 Ga0307414_10167625 Ga0307414_101676253 157
129 3300032005 Ga0307411_10000320 Ga0307411_1000032019 157
130 3300032005 Ga0307411_10522407 Ga0307411_105224071 157
131 3300032126 Ga0307415_100143218 Ga0307415_1001432182 157
132 3300037418 Ga0395900_0903024 Ga0395900_0903024_271_765 157
133 3300038443 Ga0395901_1542553 Ga0395901_1542553_86_583 157
134 3300042876 Ga0451577_0346400 Ga0451577_0346400_101_583 157
135 3300044673 Ga0453683_0290440 Ga0453683_0290440_461_943 157
136 3300049742 Ga0501080_0148964 Ga0501080_0148964_721_1203 157
137 3300049743 Ga0501081_0925354 Ga0501081_0925354_88_570 157
138 3300050489 nmdc:mga03683_27310_c1 nmdc:mga03683_27310_c1_122_613 157
139 3300050492 nmdc:mga0yw44_28970_c1 nmdc:mga0yw44_28970_c1_2656_3147 157
140 3300050507 nmdc:mga05p37_365376_c1 nmdc:mga05p37_365376_c1_642_1160 157
141 3300050507 nmdc:mga05p37_648362_c1 nmdc:mga05p37_648362_c1_437_919 157
142 3300050507 nmdc:mga05p37_71232_c1 nmdc:mga05p37_71232_c1_1651_2133 157
143 3300050508 nmdc:mga09592_32778_c1 nmdc:mga09592_32778_c1_1365_1847 157
144 3300050509 nmdc:mga0qj67_521099_c1 nmdc:mga0qj67_521099_c1_202_684 157
145 3300050510 nmdc:mga06r32_19128_c1 nmdc:mga06r32_19128_c1_3148_3630 157
146 3300050510 nmdc:mga06r32_559208_c1 nmdc:mga06r32_559208_c1_226_708 157
147 3300050510 nmdc:mga06r32_91540_c1 nmdc:mga06r32_91540_c1_630_1121 157
148 3300050511 nmdc:mga08y16_50846_c1 nmdc:mga08y16_50846_c1_848_1321 157
149 3300050513 nmdc:mga0rr50_173672_c1 nmdc:mga0rr50_173672_c1_407_928 157
150 3300050513 nmdc:mga0rr50_456578_c1 nmdc:mga0rr50_456578_c1_380_862 157
151 3300050516 nmdc:mga0sz30_177423_c1 nmdc:mga0sz30_177423_c1_382_873 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

52

174

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.9541 5 154
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.9477 5 154
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.9144 8 143
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8927 7 142
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8778 8 143
ID Description Score Start End Superfamily
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9096 10 143 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8735 8 141 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8665 8 139 3.30.530.20
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8647 10 139 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8516 10 143 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2W1N3X4-F1-model_v4 Polyketide cyclase 0.9868 13 152
AF-A0A2V5V0W3-F1-model_v4 Polyketide cyclase 0.9847 13 106
AF-A0A1H0CX14-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9841 13 149
AF-A0A529L5P0-F1-model_v4 Polyketide cyclase 0.9795 1 132
AF-C5C0D7-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9794 6 148

Feature Viewer

pLDDT pTM Quality
93.44 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map