F210962

General Info

Members Datasets Scaffolds Average Seq Length
151 87 302 280

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100010274|Ga0070679_1000102746
Length 306
Sequence MPAYLPFGAGGVTPWHDTLVAGSMAWFTRQKPSVEDTPADAEKSVRTEGLWQKCEKCSQPIWRKTLEENLFVCSNCGHHFRIDAVSRLRMLFDEGTYQEHDAGLVSNDPLGFVDSRRYHERLDSMRQTTNLPDAIISATGLLNGRRVHICALELKFIGGSMGAVVGEKITRAIERCIAEGIPLIIISASGGARMQEGAISLMQLAKISAALMKLDDARLPYVSVMTDPTTGGVTASFAMLGDINVGEPGALIGFAGPRVIEQTIRQKLPEGFQRSEFLLEHGFLDAVVKRTELKNFLDRSIRFLAG

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
19 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
32 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
33 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
34 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
35 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
36 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
37 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
38 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
39 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
40 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
46 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
47 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
48 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
49 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
52 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
53 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
54 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
55 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
56 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
57 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
58 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
71 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
72 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
73 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
76 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
77 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
78 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
79 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
80 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
84 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
85 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
86 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100010274 3300005530 Bacteria 8875
2 Ga0070683_100164287 3300005329 Bacteria 2106
3 Ga0070692_10084850 3300005345 Bacteria 1712
4 Ga0070713_100241772 3300005436 Bacteria 1644
5 Ga0070694_100326166 3300005444 Bacteria 1183
6 Ga0070663_100053384 3300005455 Bacteria 2885
7 Ga0070679_100084664 3300005530 Bacteria 3159
8 Ga0070684_100082185 3300005535 Bacteria 2852
9 Ga0070684_100196315 3300005535 Bacteria 1838
10 Ga0070665_100210483 3300005548 Bacteria 1945
11 Ga0070665_100266316 3300005548 Bacteria 1715
12 Ga0068856_100009444 3300005614 Bacteria 9472
13 Ga0075430_100012107 3300006846 Bacteria 7345
14 Ga0075431_100024371 3300006847 Bacteria 6199
15 Ga0075429_100123161 3300006880 Bacteria 2267
16 Ga0105240_10026002 3300009093 Bacteria 7687
17 Ga0105240_10028595 3300009093 Bacteria 7278
18 Ga0105243_10308623 3300009148 Bacteria 1437
19 Ga0105237_10025645 3300009545 Bacteria 6026
20 Ga0105237_10031007 3300009545 Bacteria 5423
21 Ga0105249_10141797 3300009553 Bacteria 2305
22 Ga0157370_10120307 3300013104 Bacteria 2452
23 Ga0157374_10169813 3300013296 Bacteria 2127
24 Ga0157374_10325426 3300013296 Bacteria 1524
25 Ga0213873_10040500 3300021358 Bacteria 1198
26 Ga0213876_10000805 3300021384 Bacteria 21242
27 Ga0213876_10102468 3300021384 Bacteria 1517
28 Ga0213876_10136755 3300021384 Bacteria 1303
29 Ga0213875_10000008 3300021388 Bacteria 533344
30 Ga0213875_10000041 3300021388 Bacteria 155792
31 Ga0213875_10001103 3300021388 Bacteria 18734
32 Ga0213875_10007799 3300021388 Bacteria 5500
33 Ga0213875_10013637 3300021388 Bacteria 3983
34 Ga0213875_10026029 3300021388 Bacteria 2785
35 Ga0213875_10027780 3300021388 Bacteria 2692
36 Ga0213875_10039530 3300021388 Bacteria 2223
37 Ga0213875_10078605 3300021388 Bacteria 1539
38 Ga0213875_10084801 3300021388 Bacteria 1478
39 Ga0207707_10145615 3300025912 Bacteria 2071
40 Ga0207695_10019672 3300025913 Bacteria 7764
41 Ga0207695_10050644 3300025913 Bacteria 4367
42 Ga0207695_10130468 3300025913 Bacteria 2471
43 Ga0207652_10201285 3300025921 Bacteria 1792
44 Ga0207694_10010680 3300025924 Bacteria 6930
45 Ga0207687_10209824 3300025927 Bacteria 1527
46 Ga0207678_10204695 3300026067 Bacteria 1688
47 Ga0207648_10552153 3300026089 Bacteria 1058
48 Ga0268266_10309352 3300028379 Bacteria 1476
49 Ga0265338_10161596 3300028800 Bacteria 1729
50 Ga0265328_10057777 3300031239 Bacteria 1425
51 Ga0265325_10006300 3300031241 Bacteria 7218
52 Ga0265325_10046072 3300031241 Bacteria 2263
53 Ga0373943_0115039 3300035170 Bacteria 1423
54 Ga0373946_0026597 3300035171 Bacteria 2284
55 Ga0373935_0060495 3300035692 Bacteria 2423
56 Ga0373935_0064175 3300035692 Bacteria 2355
57 Ga0373935_0218095 3300035692 Bacteria 1324
58 Ga0373927_0003447 3300035695 Bacteria 11324
59 Ga0373927_0007828 3300035695 Bacteria 7227
60 Ga0373927_0024153 3300035695 Bacteria 3977
61 Ga0373947_0058873 3300035725 Bacteria 2328
62 Ga0373937_0184813 3300036401 Bacteria 1958
63 Ga0373925_0086414 3300037068 Bacteria 2393
64 Ga0395900_0208703 3300037418 Bacteria 1973
65 Ga0395898_0281267 3300037466 Bacteria 1587
66 Ga0436364_0003113 3300037853 Bacteria 9911
67 Ga0436364_0076478 3300037853 Bacteria 3327
68 Ga0436364_0096221 3300037853 Bacteria 10527
69 Ga0436364_0145268 3300037853 Bacteria 1269
70 Ga0436364_0152089 3300037853 Bacteria 2854
71 Ga0436364_0467758 3300037853 Bacteria 119174
72 Ga0436364_0819300 3300037853 Bacteria 939
73 Ga0436364_0968720 3300037853 Bacteria 1854
74 Ga0436364_1079983 3300037853 Bacteria 3362
75 Ga0436364_1150679 3300037853 Bacteria 4740
76 Ga0436364_1216395 3300037853 Bacteria 2450
77 Ga0436364_1295591 3300037853 Bacteria 29481
78 Ga0436364_1303129 3300037853 Bacteria 6227
79 Ga0436364_1325973 3300037853 Bacteria 5149
80 Ga0436364_1415525 3300037853 Bacteria 425173
81 Ga0395901_0588871 3300038443 Bacteria 1123
82 Ga0436365_0066876 3300039437 Bacteria 2423
83 Ga0436365_0312101 3300039437 Bacteria 3996
84 Ga0436365_0315949 3300039437 Bacteria 2435
85 Ga0436365_0543891 3300039437 Bacteria 2523
86 Ga0436365_0918736 3300039437 Bacteria 4794
87 Ga0436365_1148722 3300039437 Bacteria 10968
88 Ga0436365_1400773 3300039437 Bacteria 6550
89 Ga0436360_0775237 3300039438 Bacteria 4534
90 Ga0436361_0161621 3300039447 Bacteria 2174
91 Ga0436361_0850117 3300039447 Bacteria 1052
92 Ga0436363_0406360 3300039450 Bacteria 3109
93 Ga0436363_0534313 3300039450 Bacteria 10871
94 Ga0436363_0759675 3300039450 Bacteria 3125
95 Ga0436362_0009527 3300039453 Bacteria 2693
96 Ga0436362_0152145 3300039453 Bacteria 1429
97 Ga0436362_1222367 3300039453 Bacteria 2423
98 Ga0466966_0104823 3300044684 Bacteria 1746
99 Ga0466963_0140827 3300044694 Bacteria 1671
100 Ga0453684_0153670 3300044712 Bacteria 2732
101 Ga0451576_0038722 3300045051 Bacteria 5046
102 Ga0451576_0697038 3300045051 Bacteria 1067
103 Ga0466958_0118053 3300045836 Bacteria 1659
104 Ga0495580_0023069 3300046472 Bacteria 4575
105 Ga0495665_0021083 3300046531 Bacteria 3501
106 Ga0495636_0036259 3300047318 Bacteria 2033
107 Ga0495593_0158577 3300047673 Bacteria 1143
108 Ga0501031_0008604 3300049568 Bacteria 6641
109 Ga0501032_0004897 3300049569 Bacteria 10022
110 Ga0501033_0006029 3300049570 Bacteria 9505
111 Ga0501034_0004615 3300049571 Bacteria 15270
112 Ga0501034_0067734 3300049571 Bacteria 3582
113 Ga0501036_0000334 3300049572 Bacteria 32981
114 Ga0501037_0009426 3300049573 Bacteria 7164
115 Ga0501038_0006517 3300049574 Bacteria 10799
116 Ga0501038_0134643 3300049574 Bacteria 2025
117 Ga0501039_0005858 3300049575 Bacteria 9309
118 Ga0501043_0002142 3300049579 Bacteria 16859
119 Ga0501043_0070734 3300049579 Bacteria 2741
120 Ga0501046_0001044 3300049580 Bacteria 27074
121 Ga0501047_0030286 3300049581 Bacteria 5218
122 Ga0501047_0046263 3300049581 Bacteria 4205
123 Ga0501047_0125349 3300049581 Bacteria 2449
124 Ga0501047_0137892 3300049581 Bacteria 2319
125 Ga0501048_0005305 3300049582 Bacteria 9814
126 Ga0501048_0073549 3300049582 Bacteria 2412
127 Ga0501067_0000714 3300049583 Bacteria 17915
128 Ga0501068_0002272 3300049584 Bacteria 10233
129 Ga0501069_0000576 3300049585 Bacteria 16982
130 Ga0501070_0004532 3300049586 Bacteria 11921
131 Ga0501070_0013346 3300049586 Bacteria 6929
132 Ga0501072_0002262 3300049588 Bacteria 14389
133 Ga0501073_0000736 3300049589 Bacteria 23190
134 Ga0501073_0043414 3300049589 Bacteria 3170
135 Ga0501074_0023992 3300049590 Bacteria 4432
136 Ga0501076_0014026 3300049592 Bacteria 6024
137 Ga0501079_0000630 3300049741 Bacteria 23419
138 Ga0501080_0000006 3300049742 Bacteria 138444
139 Ga0501083_0006476 3300049744 Bacteria 8306
140 Ga0501035_0013005 3300049822 Bacteria 7679
141 Ga0501035_0085035 3300049822 Bacteria 2789
142 Ga0501044_0001499 3300049823 Bacteria 27357
143 Ga0501044_0002571 3300049823 Bacteria 20668
144 Ga0501044_0004186 3300049823 Bacteria 16218
145 Ga0501044_0004700 3300049823 Bacteria 15270
146 Ga0501044_0121505 3300049823 Bacteria 2612
147 nmdc:mga05p37_382088_c1 3300050507 Bacteria 1650
148 nmdc:mga09592_116177_c1 3300050508 Bacteria 2296
149 nmdc:mga0qj67_97943_c1 3300050509 Bacteria 2362
150 nmdc:mga06r32_127165_c1 3300050510 Bacteria 2518
151 Ga0501082_0002536 3300060353 Bacteria 15992
152 Ga0070679_100010274
153 Ga0070683_100164287
154 Ga0070692_10084850
155 Ga0070713_100241772
156 Ga0070694_100326166
157 Ga0070663_100053384
158 Ga0070679_100084664
159 Ga0070684_100082185
160 Ga0070684_100196315
161 Ga0070665_100210483
162 Ga0070665_100266316
163 Ga0068856_100009444
164 Ga0075430_100012107
165 Ga0075431_100024371
166 Ga0075429_100123161
167 Ga0105240_10026002
168 Ga0105240_10028595
169 Ga0105243_10308623
170 Ga0105237_10025645
171 Ga0105237_10031007
172 Ga0105249_10141797
173 Ga0157370_10120307
174 Ga0157374_10169813
175 Ga0157374_10325426
176 Ga0213873_10040500
177 Ga0213876_10000805
178 Ga0213876_10102468
179 Ga0213876_10136755
180 Ga0213875_10000008
181 Ga0213875_10000041
182 Ga0213875_10001103
183 Ga0213875_10007799
184 Ga0213875_10013637
185 Ga0213875_10026029
186 Ga0213875_10027780
187 Ga0213875_10039530
188 Ga0213875_10078605
189 Ga0213875_10084801
190 Ga0207707_10145615
191 Ga0207695_10019672
192 Ga0207695_10050644
193 Ga0207695_10130468
194 Ga0207652_10201285
195 Ga0207694_10010680
196 Ga0207687_10209824
197 Ga0207678_10204695
198 Ga0207648_10552153
199 Ga0268266_10309352
200 Ga0265338_10161596
201 Ga0265328_10057777
202 Ga0265325_10006300
203 Ga0265325_10046072
204 Ga0373943_0115039
205 Ga0373946_0026597
206 Ga0373935_0060495
207 Ga0373935_0064175
208 Ga0373935_0218095
209 Ga0373927_0003447
210 Ga0373927_0007828
211 Ga0373927_0024153
212 Ga0373947_0058873
213 Ga0373937_0184813
214 Ga0373925_0086414
215 Ga0395900_0208703
216 Ga0395898_0281267
217 Ga0436364_0003113
218 Ga0436364_0076478
219 Ga0436364_0096221
220 Ga0436364_0145268
221 Ga0436364_0152089
222 Ga0436364_0467758
223 Ga0436364_0819300
224 Ga0436364_0968720
225 Ga0436364_1079983
226 Ga0436364_1150679
227 Ga0436364_1216395
228 Ga0436364_1295591
229 Ga0436364_1303129
230 Ga0436364_1325973
231 Ga0436364_1415525
232 Ga0395901_0588871
233 Ga0436365_0066876
234 Ga0436365_0312101
235 Ga0436365_0315949
236 Ga0436365_0543891
237 Ga0436365_0918736
238 Ga0436365_1148722
239 Ga0436365_1400773
240 Ga0436360_0775237
241 Ga0436361_0161621
242 Ga0436361_0850117
243 Ga0436363_0406360
244 Ga0436363_0534313
245 Ga0436363_0759675
246 Ga0436362_0009527
247 Ga0436362_0152145
248 Ga0436362_1222367
249 Ga0466966_0104823
250 Ga0466963_0140827
251 Ga0453684_0153670
252 Ga0451576_0038722
253 Ga0451576_0697038
254 Ga0466958_0118053
255 Ga0495580_0023069
256 Ga0495665_0021083
257 Ga0495636_0036259
258 Ga0495593_0158577
259 Ga0501031_0008604
260 Ga0501032_0004897
261 Ga0501033_0006029
262 Ga0501034_0004615
263 Ga0501034_0067734
264 Ga0501036_0000334
265 Ga0501037_0009426
266 Ga0501038_0006517
267 Ga0501038_0134643
268 Ga0501039_0005858
269 Ga0501043_0002142
270 Ga0501043_0070734
271 Ga0501046_0001044
272 Ga0501047_0030286
273 Ga0501047_0046263
274 Ga0501047_0125349
275 Ga0501047_0137892
276 Ga0501048_0005305
277 Ga0501048_0073549
278 Ga0501067_0000714
279 Ga0501068_0002272
280 Ga0501069_0000576
281 Ga0501070_0004532
282 Ga0501070_0013346
283 Ga0501072_0002262
284 Ga0501073_0000736
285 Ga0501073_0043414
286 Ga0501074_0023992
287 Ga0501076_0014026
288 Ga0501079_0000630
289 Ga0501080_0000006
290 Ga0501083_0006476
291 Ga0501035_0013005
292 Ga0501035_0085035
293 Ga0501044_0001499
294 Ga0501044_0002571
295 Ga0501044_0004186
296 Ga0501044_0004700
297 Ga0501044_0121505
298 nmdc:mga05p37_382088_c1
299 nmdc:mga09592_116177_c1
300 nmdc:mga0qj67_97943_c1
301 nmdc:mga06r32_127165_c1
302 Ga0501082_0002536

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17848

zf-ACC

Acetyl-CoA carboxylase zinc finger domain

51

76

0.99

PF01039

Carboxyl_trans

Carboxyl transferase domain

84

271

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9186 27 280
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9166 27 282
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9087 27 280
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9016 27 280
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.8916 27 280
ID Description Score Start End Superfamily
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9219 27 280 3.90.226.10
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9166 27 282 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9087 27 280 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8984 27 280 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8916 27 280 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7V9NP73-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9423 27 281 GO:0003989
GO:0005524
GO:0006633
GO:0008270
GO:0009317
GO:0016743
GO:2001295
AF-A0A496B4H3-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9414 28 283 GO:0003989
GO:0005524
GO:0006633
GO:0008270
GO:0009317
GO:0016743
GO:2001295
AF-A0A7C1PWS2-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9402 26 283 GO:0003989
GO:0005524
GO:0006633
GO:0008270
GO:0009317
GO:0016743
GO:2001295
AF-A0A350D4F3-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9396 27 282 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016740
GO:0046872
GO:2001295
AF-A0A1W7QTZ9-F1-model_v4 deleted 0.9373 25 281

Map