F207480

General Info

Members Datasets Scaffolds Average Seq Length
149 85 298 203

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8019608314|8019617111
Length 227
Sequence DDILASIQANLPRLDRPLPHVPLFDDDPPASLLSAFKDNLHRMGGVFLDPPTSGDILAPVRAKIADAKVVCSTVPEIVGNRDIAGVGAPRDLADIDFAIVRASFAVAETGSVLLSDADLHINAVAYLAQHLIVLVDPADIVVNLHHAYRRPEFRDSHYASFHTGPSATADIEGVLIHGAQGRALAFRPSGCASREQASFAETEVRSSPAVHRRRRKKRSESNIGTAR

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
33 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
57 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
58 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
59 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
60 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
61 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
62 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
63 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
64 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
65 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
66 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
67 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
68 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
69 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
70 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
71 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
72 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
73 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
74 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
75 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
76 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
77 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
78 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
79 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
80 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
83 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
84 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
85 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.96
Metatranscriptomes 0
Isolates 6.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.38
Nodule 6.71
Rhizoplane 0.67
Rhizosphere 76.51
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1001397 3300002987 Bacteria 10014
2 JGI25160J50197_1000549 3300003354 Bacteria 21259
3 JGI25161J50226_1000401 3300003374 Bacteria 21259
4 JGI25404J52841_10000322 3300003659 Bacteria 6343
5 Ga0055543_1000540 3300004625 Bacteria 21297
6 Ga0065165_1001791 3300005262 Bacteria 21182
7 Ga0065707_10213860 3300005295 Bacteria 1238
8 Ga0070709_10100351 3300005434 Bacteria 1927
9 Ga0070714_100665928 3300005435 Bacteria 1003
10 Ga0070713_100381749 3300005436 Unclassified 1313
11 Ga0070713_100715323 3300005436 Bacteria 957
12 Ga0070710_10586676 3300005437 Bacteria 774
13 Ga0070711_100151215 3300005439 Bacteria 1750
14 Ga0070706_100417575 3300005467 Bacteria 1249
15 Ga0070665_100107751 3300005548 Bacteria 2789
16 Ga0068861_100086071 3300005719 Bacteria 2470
17 Ga0081540_1000011 3300005983 Bacteria 191880
18 Ga0081540_1000021 3300005983 Bacteria 161624
19 Ga0070717_10097478 3300006028 Bacteria 2491
20 Ga0070717_10610269 3300006028 Bacteria 990
21 Ga0075365_10206212 3300006038 Bacteria 1378
22 Ga0070715_10056835 3300006163 Bacteria 1703
23 Ga0070712_100150537 3300006175 Bacteria 1786
24 Ga0070712_100395802 3300006175 Bacteria 1140
25 Ga0070712_100433297 3300006175 Bacteria 1092
26 Ga0070712_100487256 3300006175 Bacteria 1032
27 Ga0070712_100685012 3300006175 Bacteria 873
28 Ga0070712_101016525 3300006175 Bacteria 718
29 Ga0075367_10132506 3300006178 Bacteria 1541
30 Ga0075428_100045119 3300006844 Bacteria 4843
31 Ga0075433_10682276 3300006852 Bacteria 900
32 Ga0075433_11179783 3300006852 Bacteria 665
33 Ga0075434_100036786 3300006871 Bacteria 4842
34 Ga0075429_100134315 3300006880 Bacteria 2165
35 Ga0075436_100243924 3300006914 Bacteria 1278
36 Ga0075436_100323624 3300006914 Bacteria 1108
37 Ga0075435_100009518 3300007076 Bacteria 7041
38 Ga0075435_100082817 3300007076 Bacteria 2637
39 Ga0075435_100245172 3300007076 Bacteria 1524
40 Ga0075435_100937466 3300007076 Unclassified 755
41 Ga0099794_10108999 3300007265 Bacteria 1386
42 Ga0099795_10001071 3300007788 Bacteria 5656
43 Ga0099795_10007324 3300007788 Bacteria 3071
44 Ga0111539_10011933 3300009094 Bacteria 10892
45 Ga0111539_10103714 3300009094 Bacteria 3337
46 Ga0111539_10267728 3300009094 Bacteria 1989
47 Ga0111539_10384330 3300009094 Bacteria 1635
48 Ga0111539_10957328 3300009094 Bacteria 995
49 Ga0114129_10304997 3300009147 Bacteria 2121
50 Ga0114129_10621329 3300009147 Bacteria 1398
51 Ga0114129_11480333 3300009147 Unclassified 835
52 Ga0114129_12053687 3300009147 Bacteria 690
53 Ga0123342_1011246 3300009766 Bacteria 9871
54 Ga0099796_10110027 3300010159 Bacteria 1047
55 Ga0213872_10003173 3300021361 Bacteria 9224
56 Ga0213872_10080459 3300021361 Bacteria 1464
57 Ga0213872_10262563 3300021361 Bacteria 725
58 Ga0213872_10274227 3300021361 Archaea 706
59 Ga0213874_10001597 3300021377 Bacteria 4750
60 Ga0213875_10077455 3300021388 Bacteria 1552
61 Ga0213871_10007132 3300021441 Bacteria 2402
62 Ga0213871_10010522 3300021441 Bacteria 2100
63 Ga0213871_10045125 3300021441 Bacteria 1193
64 Ga0209130_1000409 3300025284 Bacteria 46757
65 Ga0207426_1000269 3300025302 Bacteria 109050
66 Ga0207692_10582594 3300025898 Bacteria 718
67 Ga0207685_10266863 3300025905 Bacteria 834
68 Ga0207699_10189832 3300025906 Bacteria 1386
69 Ga0207699_10331873 3300025906 Bacteria 1069
70 Ga0207684_10343297 3300025910 Bacteria 1286
71 Ga0207693_10033957 3300025915 Bacteria 4025
72 Ga0207693_10045465 3300025915 Bacteria 3450
73 Ga0207693_10387797 3300025915 Bacteria 1092
74 Ga0207663_10159013 3300025916 Bacteria 1593
75 Ga0207700_10521163 3300025928 Unclassified 1053
76 Ga0207668_10271764 3300025972 Bacteria 1386
77 Ga0207708_10037462 3300026075 Bacteria 3695
78 Ga0207675_100150461 3300026118 Bacteria 2215
79 Ga0209179_1005324 3300027512 Bacteria 2005
80 Ga0209179_1016666 3300027512 Bacteria 1381
81 Ga0209588_1012305 3300027671 Bacteria 2596
82 Ga0207428_10387585 3300027907 Bacteria 1024
83 Ga0268266_10071790 3300028379 Bacteria 3001
84 Ga0373940_0114289 3300035088 Unclassified 832
85 Ga0373935_0271818 3300035692 Bacteria 1191
86 Ga0373937_0542002 3300036401 Bacteria 1105
87 Ga0436365_0552205 3300039437 Bacteria 1421
88 Ga0436360_0029670 3300039438 Bacteria 1521
89 Ga0436360_0045346 3300039438 Bacteria 1913
90 Ga0436360_0107494 3300039438 Bacteria 1748
91 Ga0436360_0164282 3300039438 Bacteria 810
92 Ga0436360_0242079 3300039438 Bacteria 1309
93 Ga0436360_0387503 3300039438 Bacteria 5336
94 Ga0436360_0707652 3300039438 Bacteria 4566
95 Ga0436360_0859192 3300039438 Bacteria 1422
96 Ga0436360_0931132 3300039438 Bacteria 7505
97 Ga0436360_0950925 3300039438 Bacteria 2151
98 Ga0436360_1099272 3300039438 Bacteria 1084
99 Ga0436360_1122898 3300039438 Bacteria 692
100 Ga0436360_1141290 3300039438 Bacteria 2084
101 Ga0436360_1204836 3300039438 Bacteria 1881
102 Ga0436360_1266860 3300039438 Bacteria 1513
103 Ga0436361_0052624 3300039447 Bacteria 2130
104 Ga0436361_0215289 3300039447 Bacteria 4319
105 Ga0436361_0367221 3300039447 Bacteria 3213
106 Ga0436361_0412309 3300039447 Bacteria 1807
107 Ga0436361_0436817 3300039447 Bacteria 842
108 Ga0436361_0506678 3300039447 Bacteria 3582
109 Ga0436361_0598250 3300039447 Bacteria 1327
110 Ga0436361_0620934 3300039447 Bacteria 1173
111 Ga0436361_0637813 3300039447 Bacteria 1308
112 Ga0436361_0806271 3300039447 Bacteria 11799
113 Ga0436361_0878179 3300039447 Bacteria 1490
114 Ga0436363_0096912 3300039450 Bacteria 8157
115 Ga0436363_0279083 3300039450 Bacteria 1383
116 Ga0436363_0284898 3300039450 Bacteria 6214
117 Ga0436363_1041553 3300039450 Bacteria 2734
118 Ga0436363_1494222 3300039450 Bacteria 5890
119 Ga0436362_0056121 3300039453 Bacteria 825
120 Ga0436362_0418221 3300039453 Bacteria 846
121 Ga0436362_0872762 3300039453 Bacteria 991
122 Ga0436362_0968257 3300039453 Bacteria 1048
123 Ga0496101_0421054 3300048904 Bacteria 1053
124 Ga0496119_0028554 3300048922 Bacteria 3804
125 Ga0496121_0009421 3300048924 Bacteria 11226
126 Ga0496121_0139856 3300048924 Bacteria 1798
127 Ga0496124_0011936 3300048927 Bacteria 8644
128 Ga0496126_0002693 3300048929 Bacteria 23473
129 nmdc:mga05p37_232299_c1 3300050507 Bacteria 2221
130 nmdc:mga09592_132670_c1 3300050508 Bacteria 2144
131 nmdc:mga08y16_54985_c1 3300050511 Bacteria 4160
132 nmdc:mga0n895_42951_c1 3300050512 Bacteria 4402
133 nmdc:mga0n895_59919_c1 3300050512 Bacteria 3755
134 nmdc:mga0rr50_21254_c1 3300050513 Bacteria 4426
135 nmdc:mga0rr50_327177_c1 3300050513 Bacteria 1286
136 nmdc:mga08x19_400318_c1 3300050514 Bacteria 963
137 nmdc:mga0a205_1073058_c1 3300050515 Unclassified 653
138 nmdc:mga0sz30_88115_c1 3300050516 Bacteria 1348
139 Ga0495619_0498856 3300053085 Bacteria 837
140 Ga0500645_008487 3300053730 Bacteria 3505
141 8019617111 8019608314 Bacteria 10042931
142 2509148465 2508501128 Bacteria 8613869
143 2513642425 2513237094 Bacteria 8789602
144 2524539689 2524023228 Bacteria 10118060
145 2879106885 2879099564 Bacteria 10442239
146 2932801739 2932801729 Bacteria 7987968
147 2935870189 2935864058 Bacteria 9784707
148 8019589830 8019586578 Bacteria 10212056
149 8019601443 8019597564 Bacteria 10041141
150 JGI25159J45721_1001397
151 JGI25160J50197_1000549
152 JGI25161J50226_1000401
153 JGI25404J52841_10000322
154 Ga0055543_1000540
155 Ga0065165_1001791
156 Ga0065707_10213860
157 Ga0070709_10100351
158 Ga0070714_100665928
159 Ga0070713_100381749
160 Ga0070713_100715323
161 Ga0070710_10586676
162 Ga0070711_100151215
163 Ga0070706_100417575
164 Ga0070665_100107751
165 Ga0068861_100086071
166 Ga0081540_1000011
167 Ga0081540_1000021
168 Ga0070717_10097478
169 Ga0070717_10610269
170 Ga0075365_10206212
171 Ga0070715_10056835
172 Ga0070712_100150537
173 Ga0070712_100395802
174 Ga0070712_100433297
175 Ga0070712_100487256
176 Ga0070712_100685012
177 Ga0070712_101016525
178 Ga0075367_10132506
179 Ga0075428_100045119
180 Ga0075433_10682276
181 Ga0075433_11179783
182 Ga0075434_100036786
183 Ga0075429_100134315
184 Ga0075436_100243924
185 Ga0075436_100323624
186 Ga0075435_100009518
187 Ga0075435_100082817
188 Ga0075435_100245172
189 Ga0075435_100937466
190 Ga0099794_10108999
191 Ga0099795_10001071
192 Ga0099795_10007324
193 Ga0111539_10011933
194 Ga0111539_10103714
195 Ga0111539_10267728
196 Ga0111539_10384330
197 Ga0111539_10957328
198 Ga0114129_10304997
199 Ga0114129_10621329
200 Ga0114129_11480333
201 Ga0114129_12053687
202 Ga0123342_1011246
203 Ga0099796_10110027
204 Ga0213872_10003173
205 Ga0213872_10080459
206 Ga0213872_10262563
207 Ga0213872_10274227
208 Ga0213874_10001597
209 Ga0213875_10077455
210 Ga0213871_10007132
211 Ga0213871_10010522
212 Ga0213871_10045125
213 Ga0209130_1000409
214 Ga0207426_1000269
215 Ga0207692_10582594
216 Ga0207685_10266863
217 Ga0207699_10189832
218 Ga0207699_10331873
219 Ga0207684_10343297
220 Ga0207693_10033957
221 Ga0207693_10045465
222 Ga0207693_10387797
223 Ga0207663_10159013
224 Ga0207700_10521163
225 Ga0207668_10271764
226 Ga0207708_10037462
227 Ga0207675_100150461
228 Ga0209179_1005324
229 Ga0209179_1016666
230 Ga0209588_1012305
231 Ga0207428_10387585
232 Ga0268266_10071790
233 Ga0373940_0114289
234 Ga0373935_0271818
235 Ga0373937_0542002
236 Ga0436365_0552205
237 Ga0436360_0029670
238 Ga0436360_0045346
239 Ga0436360_0107494
240 Ga0436360_0164282
241 Ga0436360_0242079
242 Ga0436360_0387503
243 Ga0436360_0707652
244 Ga0436360_0859192
245 Ga0436360_0931132
246 Ga0436360_0950925
247 Ga0436360_1099272
248 Ga0436360_1122898
249 Ga0436360_1141290
250 Ga0436360_1204836
251 Ga0436360_1266860
252 Ga0436361_0052624
253 Ga0436361_0215289
254 Ga0436361_0367221
255 Ga0436361_0412309
256 Ga0436361_0436817
257 Ga0436361_0506678
258 Ga0436361_0598250
259 Ga0436361_0620934
260 Ga0436361_0637813
261 Ga0436361_0806271
262 Ga0436361_0878179
263 Ga0436363_0096912
264 Ga0436363_0279083
265 Ga0436363_0284898
266 Ga0436363_1041553
267 Ga0436363_1494222
268 Ga0436362_0056121
269 Ga0436362_0418221
270 Ga0436362_0872762
271 Ga0436362_0968257
272 Ga0496101_0421054
273 Ga0496119_0028554
274 Ga0496121_0009421
275 Ga0496121_0139856
276 Ga0496124_0011936
277 Ga0496126_0002693
278 nmdc:mga05p37_232299_c1
279 nmdc:mga09592_132670_c1
280 nmdc:mga08y16_54985_c1
281 nmdc:mga0n895_42951_c1
282 nmdc:mga0n895_59919_c1
283 nmdc:mga0rr50_21254_c1
284 nmdc:mga0rr50_327177_c1
285 nmdc:mga08x19_400318_c1
286 nmdc:mga0a205_1073058_c1
287 nmdc:mga0sz30_88115_c1
288 Ga0495619_0498856
289 Ga0500645_008487
290 8019617111
291 2509148465
292 2513642425
293 2524539689
294 2879106885
295 2932801739
296 2935870189
297 8019589830
298 8019601443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02589

LUD_dom

LUD domain

55

183

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g40-assembly1.cif.gz_A-2 crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 a resolution 0.7457 36 191
2g40-assembly1.cif.gz_A-2 crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 a resolution 0.7002 36 191
5b04-assembly1.cif.gz_D crystal structure of the eukaryotic translation initiation factor 2b from schizosaccharomyces pombe 0.6922 93 147
6jly-assembly1.cif.gz_C eif2a - eif2b complex 0.6913 93 146
6jlz-assembly1.cif.gz_D p-eif2a - eif2b complex 0.6805 93 146
ID Description Score Start End Superfamily
2g40A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.7457 36 191 3.40.50.10420
2g40A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.7002 36 191 3.40.50.10420
af_P77433_40_228_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.6943 36 194 3.40.50.10420
4zemA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Translation initiation factor eif-2b; domain 2 0.6867 93 147 3.40.50.10470
af_Q8I4S8_478_676_3.40.50.10470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Translation initiation factor eif-2b; domain 2 0.6842 93 146 3.40.50.10470
ID Description Score Start End GO Terms
AF-A0A5C8WCP2-F1-model_v4 LUD domain-containing protein 0.8695 27 200
AF-A0A2U8HWV2-F1-model_v4 deleted 0.8596 64 197
AF-A0A5C8WCP2-F1-model_v4 LUD domain-containing protein 0.8553 27 200
AF-A0A2U8HWV2-F1-model_v4 deleted 0.8474 64 197
AF-A0A4V6JPZ8-F1-model_v4 deleted 0.8454 35 196

Map