F206030

General Info

Members Datasets Scaffolds Average Seq Length
149 113 296 577

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10101991|Ga0157372_101019912
Length 639
Sequence MTFRQWFRYVALLLCLAGPAIAAEAPAGKWWNNAVIYEIYPRSFQDSNGDGIGDLNGITQRLDYLKSIGVDAIWIGPMYPSPQVDFGYDISDYENVDPQYGTLADFDRLVAEAGKRHIRVLLDMVLNHTSDQHPWFKSAAASRKDPKHDWYVWNDGRIDAAGKHQPPNNWVSLFGGSAWQWVPAVNQFYYHEFYRAQPDLNWRNPQVEKAMFDALRFWLDRGVAGFRLDAITTVFEDAQLRDEPVTGPGVNAQGDPLVSRIYTDNLPEVHDVIRRMRKMVDGYAGDRVLIGETYLPNTAELDKWYGGTHHDELHLPMDMLVGFTNKLDAVTLRNRLTEVQTQVHGSQPMLVFDNHDNIRSWERYGDGVHNEQIAKIIATLLLTSRATALLYQGEEIGQVTTTPTRVEDVRDPIGITGWPKEKGRDGERTPMQWDASNPQAGFSTNPKTWLPVPPSYKTINVQSEQADPQSILGWHRQLTTLRRTNPALANGTMQMLDVQNTKVLSYARVAKGGQTVLVALNMSDTPQTVSLDTKGTKPLKTLMASPAGMTAPKSAAAVTLPPFGAWVGAQYRGYLTRCLPSFLASVSEILNPVSASVSWIRSHSSVLIDVGRSVKPTSALPSARPNAASISSVLDGLAR

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
111 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
112 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
113 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 1.34
Rhizosphere 83.22
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10101991 3300013307 Bacteria 3277
2 JGI24738J21930_10000975 3300002075 Bacteria 8198
3 rootH1_10037443 3300003316 Bacteria 6398
4 Ga0070683_100065367 3300005329 Bacteria 3386
5 Ga0070680_100006947 3300005336 Bacteria 8626
6 Ga0070671_100000483 3300005355 Bacteria 27720
7 Ga0070667_100005369 3300005367 Bacteria 10704
8 Ga0070709_10021552 3300005434 Unclassified 3755
9 Ga0070709_10073171 3300005434 Bacteria 2218
10 Ga0070713_100124956 3300005436 Bacteria 2261
11 Ga0070711_100063374 3300005439 Bacteria 2580
12 Ga0070681_10000738 3300005458 Bacteria 27069
13 Ga0068867_100104698 3300005459 Bacteria 2166
14 Ga0070706_100037272 3300005467 Bacteria 4491
15 Ga0070679_100000280 3300005530 Bacteria 43099
16 Ga0070684_100071196 3300005535 Bacteria 3061
17 Ga0070697_100002612 3300005536 Bacteria 13868
18 Ga0070695_100001638 3300005545 Bacteria 12579
19 Ga0070665_100085322 3300005548 Bacteria 3163
20 Ga0068855_100110061 3300005563 Bacteria 3162
21 Ga0068852_100033422 3300005616 Bacteria 4270
22 Ga0068859_100000181 3300005617 Bacteria 61904
23 Ga0068851_10014109 3300005834 Bacteria 3789
24 Ga0068863_100011412 3300005841 Bacteria 8596
25 Ga0068863_100024168 3300005841 Bacteria 5797
26 Ga0068858_100000734 3300005842 Bacteria 34350
27 Ga0068858_100000878 3300005842 Bacteria 31153
28 Ga0068860_100001535 3300005843 Bacteria 24870
29 Ga0068862_100010757 3300005844 Bacteria 7553
30 Ga0070717_10001669 3300006028 Bacteria 15439
31 Ga0070717_10063774 3300006028 Bacteria 3059
32 Ga0097621_100000396 3300006237 Bacteria 30373
33 Ga0068871_100000260 3300006358 Bacteria 36409
34 Ga0068871_100028034 3300006358 Bacteria 4411
35 Ga0097620_100000181 3300006931 Bacteria 61904
36 Ga0099794_10002829 3300007265 Bacteria 6500
37 Ga0099794_10003936 3300007265 Bacteria 5760
38 Ga0099794_10013347 3300007265 Bacteria 3574
39 Ga0099794_10016929 3300007265 Bacteria 3241
40 Ga0099794_10021336 3300007265 Bacteria 2942
41 Ga0099795_10000009 3300007788 Bacteria 84256
42 Ga0105250_10018804 3300009092 Bacteria 2795
43 Ga0105240_10041569 3300009093 Bacteria 5867
44 Ga0105240_10057589 3300009093 Bacteria 4854
45 Ga0105240_10156659 3300009093 Bacteria 2708
46 Ga0105245_10014273 3300009098 Bacteria 6922
47 Ga0105247_10000549 3300009101 Bacteria 30547
48 Ga0105247_10026902 3300009101 Bacteria 3477
49 Ga0114129_10119279 3300009147 Bacteria 3633
50 Ga0105248_10046506 3300009177 Bacteria 4864
51 Ga0105238_10011361 3300009551 Bacteria 8962
52 Ga0105238_10013678 3300009551 Bacteria 8195
53 Ga0105238_10099564 3300009551 Bacteria 2890
54 Ga0105249_10050011 3300009553 Bacteria 3812
55 Ga0099796_10000162 3300010159 Bacteria 9956
56 Ga0157370_10077121 3300013104 Bacteria 3140
57 Ga0157369_10066108 3300013105 Bacteria 3890
58 Ga0157374_10005052 3300013296 Bacteria 11067
59 Ga0157374_10078201 3300013296 Bacteria 3132
60 Ga0157374_10170794 3300013296 Bacteria 2121
61 Ga0157378_10000350 3300013297 Bacteria 45204
62 Ga0157378_10102225 3300013297 Bacteria 2618
63 Ga0157375_10220635 3300013308 Bacteria 2054
64 Ga0163163_10016834 3300014325 Bacteria 6804
65 Ga0182008_10002793 3300014497 Bacteria 10808
66 Ga0157379_10175387 3300014968 Bacteria 1936
67 Ga0213875_10000055 3300021388 Bacteria 139636
68 Ga0207699_10064384 3300025906 Bacteria 2218
69 Ga0207684_10070665 3300025910 Bacteria 2967
70 Ga0207707_10001614 3300025912 Bacteria 20779
71 Ga0207695_10020562 3300025913 Bacteria 7556
72 Ga0207695_10061069 3300025913 Bacteria 3897
73 Ga0207671_10096408 3300025914 Bacteria 2235
74 Ga0207693_10047158 3300025915 Bacteria 3386
75 Ga0207693_10072236 3300025915 Bacteria 2702
76 Ga0207694_10036228 3300025924 Bacteria 3786
77 Ga0207664_10016539 3300025929 Bacteria 5383
78 Ga0207665_10133930 3300025939 Bacteria 1761
79 Ga0207711_10067370 3300025941 Bacteria 3099
80 Ga0207661_10068178 3300025944 Bacteria 2896
81 Ga0207667_10092586 3300025949 Bacteria 3122
82 Ga0207667_10170100 3300025949 Bacteria 2240
83 Ga0207658_10007666 3300025986 Bacteria 7350
84 Ga0207677_10019031 3300026023 Bacteria 4136
85 Ga0207703_10000459 3300026035 Bacteria 42871
86 Ga0207703_10001239 3300026035 Bacteria 23890
87 Ga0207639_10025410 3300026041 Bacteria 4294
88 Ga0207641_10000872 3300026088 Bacteria 31574
89 Ga0209179_1000022 3300027512 Bacteria 42480
90 Ga0209588_1001346 3300027671 Bacteria 6393
91 Ga0268266_10005781 3300028379 Bacteria 11453
92 Ga0268266_10030978 3300028379 Bacteria 4543
93 Ga0268265_10012532 3300028380 Bacteria 5746
94 Ga0268264_10000100 3300028381 Bacteria 227852
95 Ga0268264_10022466 3300028381 Bacteria 5151
96 Ga0265336_10001139 3300028666 Bacteria 12730
97 Ga0265338_10006744 3300028800 Bacteria 14499
98 Ga0265330_10000144 3300031235 Bacteria 57603
99 Ga0265328_10000483 3300031239 Bacteria 18524
100 Ga0265340_10008504 3300031247 Bacteria 5539
101 Ga0265340_10020363 3300031247 Bacteria 3410
102 Ga0265339_10000026 3300031249 Bacteria 165764
103 Ga0265339_10001544 3300031249 Bacteria 17008
104 Ga0265339_10012760 3300031249 Bacteria 5110
105 Ga0265331_10024105 3300031250 Bacteria 3083
106 Ga0265316_10020678 3300031344 Bacteria 5595
107 Ga0265316_10038046 3300031344 Bacteria 3879
108 Ga0307513_10003388 3300031456 Bacteria 21658
109 Ga0307509_10000028 3300031507 Bacteria 223572
110 Ga0265313_10000156 3300031595 Bacteria 70944
111 Ga0265313_10049971 3300031595 Bacteria 2009
112 Ga0265314_10013607 3300031711 Bacteria 6562
113 Ga0265342_10000771 3300031712 Bacteria 32633
114 Ga0265342_10002597 3300031712 Bacteria 15465
115 Ga0265342_10014777 3300031712 Bacteria 5171
116 Ga0307412_10000398 3300031911 Bacteria 26507
117 Ga0307510_10000001 3300033180 Bacteria 1172244
118 Ga0436364_1041182 3300037853 Bacteria 4132
119 Ga0436364_1298937 3300037853 Bacteria 123533
120 Ga0436363_0515456 3300039450 Bacteria 9396
121 Ga0436363_1141332 3300039450 Bacteria 12924
122 Ga0439436_0000007 3300041404 Bacteria 120812
123 Ga0439465_0002059 3300041413 Bacteria 6596
124 Ga0466966_0010225 3300044684 Bacteria 6224
125 Ga0466964_0001137 3300044706 Bacteria 8975
126 Ga0466971_0001149 3300044719 Bacteria 11005
127 Ga0451576_0027392 3300045051 Bacteria 6121
128 Ga0495610_0000927 3300046512 Bacteria 27234
129 Ga0495670_0001902 3300046691 Bacteria 10295
130 Ga0495686_0000446 3300047472 Bacteria 62459
131 Ga0496108_0069464 3300048911 Bacteria 2973
132 Ga0496115_0211933 3300048918 Bacteria 1600
133 Ga0496116_0047559 3300048919 Bacteria 2887
134 Ga0496117_0002640 3300048920 Bacteria 22229
135 Ga0496118_0000038 3300048921 Bacteria 315464
136 Ga0496119_0004280 3300048922 Bacteria 14289
137 Ga0496119_0008044 3300048922 Bacteria 9365
138 Ga0496120_0000591 3300048923 Bacteria 54957
139 Ga0496121_0002995 3300048924 Bacteria 24532
140 Ga0496125_0000325 3300048928 Bacteria 92684
141 Ga0496125_0002239 3300048928 Bacteria 25711
142 Ga0496125_0018134 3300048928 Bacteria 6691
143 Ga0496126_0012518 3300048929 Bacteria 8685
144 Ga0500637_0005605 3300053178 Bacteria 6101
145 Ga0466962_0000667 3300061719 Bacteria 15242
146 2595447517 2593339238 Bacteria 4182970
147 2842920613 2842918807 Bacteria 4289178
148 2953995902 2953994433 Bacteria 4303959
149 Ga0157372_10101991
150 JGI24738J21930_10000975
151 rootH1_10037443
152 Ga0070683_100065367
153 Ga0070680_100006947
154 Ga0070671_100000483
155 Ga0070667_100005369
156 Ga0070709_10021552
157 Ga0070709_10073171
158 Ga0070713_100124956
159 Ga0070711_100063374
160 Ga0070681_10000738
161 Ga0068867_100104698
162 Ga0070706_100037272
163 Ga0070679_100000280
164 Ga0070684_100071196
165 Ga0070697_100002612
166 Ga0070695_100001638
167 Ga0070665_100085322
168 Ga0068855_100110061
169 Ga0068852_100033422
170 Ga0068859_100000181
171 Ga0068851_10014109
172 Ga0068863_100011412
173 Ga0068863_100024168
174 Ga0068858_100000734
175 Ga0068858_100000878
176 Ga0068860_100001535
177 Ga0068862_100010757
178 Ga0070717_10001669
179 Ga0070717_10063774
180 Ga0097621_100000396
181 Ga0068871_100000260
182 Ga0068871_100028034
183 Ga0097620_100000181
184 Ga0099794_10002829
185 Ga0099794_10003936
186 Ga0099794_10013347
187 Ga0099794_10016929
188 Ga0099794_10021336
189 Ga0099795_10000009
190 Ga0105250_10018804
191 Ga0105240_10041569
192 Ga0105240_10057589
193 Ga0105240_10156659
194 Ga0105245_10014273
195 Ga0105247_10000549
196 Ga0105247_10026902
197 Ga0114129_10119279
198 Ga0105248_10046506
199 Ga0105238_10011361
200 Ga0105238_10013678
201 Ga0105238_10099564
202 Ga0105249_10050011
203 Ga0099796_10000162
204 Ga0157370_10077121
205 Ga0157369_10066108
206 Ga0157374_10005052
207 Ga0157374_10078201
208 Ga0157374_10170794
209 Ga0157378_10000350
210 Ga0157378_10102225
211 Ga0157375_10220635
212 Ga0163163_10016834
213 Ga0182008_10002793
214 Ga0157379_10175387
215 Ga0213875_10000055
216 Ga0207699_10064384
217 Ga0207684_10070665
218 Ga0207707_10001614
219 Ga0207695_10020562
220 Ga0207695_10061069
221 Ga0207671_10096408
222 Ga0207693_10047158
223 Ga0207693_10072236
224 Ga0207694_10036228
225 Ga0207664_10016539
226 Ga0207665_10133930
227 Ga0207711_10067370
228 Ga0207661_10068178
229 Ga0207667_10092586
230 Ga0207667_10170100
231 Ga0207658_10007666
232 Ga0207677_10019031
233 Ga0207703_10000459
234 Ga0207703_10001239
235 Ga0207639_10025410
236 Ga0207641_10000872
237 Ga0209179_1000022
238 Ga0209588_1001346
239 Ga0268266_10005781
240 Ga0268266_10030978
241 Ga0268265_10012532
242 Ga0268264_10000100
243 Ga0268264_10022466
244 Ga0265336_10001139
245 Ga0265338_10006744
246 Ga0265330_10000144
247 Ga0265328_10000483
248 Ga0265340_10008504
249 Ga0265340_10020363
250 Ga0265339_10000026
251 Ga0265339_10001544
252 Ga0265339_10012760
253 Ga0265331_10024105
254 Ga0265316_10020678
255 Ga0265316_10038046
256 Ga0307513_10003388
257 Ga0307509_10000028
258 Ga0265313_10000156
259 Ga0265313_10049971
260 Ga0265314_10013607
261 Ga0265342_10000771
262 Ga0265342_10002597
263 Ga0265342_10014777
264 Ga0307412_10000398
265 Ga0307510_10000001
266 Ga0436364_1041182
267 Ga0436364_1298937
268 Ga0436363_0515456
269 Ga0436363_1141332
270 Ga0439436_0000007
271 Ga0439465_0002059
272 Ga0466966_0010225
273 Ga0466964_0001137
274 Ga0466971_0001149
275 Ga0451576_0027392
276 Ga0495610_0000927
277 Ga0495670_0001902
278 Ga0495686_0000446
279 Ga0496108_0069464
280 Ga0496115_0211933
281 Ga0496116_0047559
282 Ga0496117_0002640
283 Ga0496118_0000038
284 Ga0496119_0004280
285 Ga0496119_0008044
286 Ga0496120_0000591
287 Ga0496121_0002995
288 Ga0496125_0000325
289 Ga0496125_0002239
290 Ga0496125_0018134
291 Ga0496126_0012518
292 Ga0500637_0005605
293 Ga0466962_0000667
294 2595447517
295 2842920613
296 2953995902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

53

404

0.92

PF11941

DUF3459

Domain of unknown function (DUF3459)

474

567

0.82

PF16657

Malt_amylase_C

Maltogenic Amylase, C-terminal domain

491

567

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7voh-assembly2.cif.gz_B the a-glucosidase qsgh13 from qipengyuania seohaensis 0.9223 30 578
7voh-assembly2.cif.gz_B the a-glucosidase qsgh13 from qipengyuania seohaensis 0.9171 30 578
7voh-assembly1.cif.gz_A the a-glucosidase qsgh13 from qipengyuania seohaensis 0.9137 30 578
3wy2-assembly1.cif.gz_A crystal structure of alpha-glucosidase in complex with glucose 0.9126 31 580
3wy3-assembly1.cif.gz_A crystal structure of alpha-glucosidase mutant d202n in complex with glucose and glycerol 0.9117 31 580
ID Description Score Start End Superfamily
af_P28904_107_175_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9376 131 217 3.20.20.80
af_Q5U124_144_216_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9315 131 217 3.20.20.80
af_P40884_109_184_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9253 131 217 3.20.20.80
af_P28904_107_175_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9245 131 217 3.20.20.80
af_Q5U124_144_216_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9193 131 217 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A838PLX5-F1-model_v4 Alpha-amylase 0.9976 31 139 GO:0004556
GO:0009313
AF-A0A0E1Y526-F1-model_v4 deleted 0.9941 35 232
AF-A0A355DD80-F1-model_v4 Alpha-amylase 0.9892 58 154 GO:0004556
GO:0009313
AF-A0A5M9Z6R1-F1-model_v4 deleted 0.9853 28 125
AF-A5MAZ0-F1-model_v4 deleted 0.985 35 125

Map