F204403

General Info

Members Datasets Scaffolds Average Seq Length
148 82 296 286

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0306530|Ga0501080_0306530_44_1069
Length 341
Sequence MEPLENPVLYDEIEYAAVHPIGESQLTGSLWVPGPCPCGLYTPSPYLSAGLVSGFDCHLWGESNGMFNPTELLIHAFVDRLQEAYWNTYGQWEPSYPGIIRWAGHMALESIANSDALYHNVEHTIMVTLVGQQILKGKHLREGGVLPNDWLHFIISLLCHDIGYIRGVCRDDHDNICTTGVTGETIVLPSSATDASLTPYHIDRGKLFIQERFGGHHLIDADIIAVNIERTRFPVPDDSDHQGTSDYPGLVRAADLIGQLADPHHMRKFPALFYEFEETGTNAKLGYKSPGDLRGDYPSFYWNVIYRYIQDGLHYLRMTQEGKQWIANLYAHVFSVEHHQP

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
18 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
24 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
25 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
26 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
27 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
28 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
29 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
30 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
31 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
32 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
34 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
35 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
36 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
37 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
41 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
42 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
43 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
44 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
45 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
46 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
47 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
48 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
49 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
54 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
55 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
56 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
57 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
58 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
59 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
60 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
61 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
62 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
63 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
64 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
65 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
66 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
67 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
68 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
69 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
70 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
71 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
72 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
73 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
74 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
75 2831426010 Nostoc sp. 106C Isolate Unclassified
76 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
77 2849660919 Nostoc sp. T09 Isolate Unclassified
78 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
79 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
80 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
81 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
82 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.57
Metatranscriptomes 1.35
Isolates 6.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.73
Nodule 0
Rhizoplane 0
Rhizosphere 84.46
Stem 0
Stem Tuber 0
Unclassified 20.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0306530 3300049742 Unclassified 1440
2 JGI25405J52794_10002222 3300003911 Bacteria 3316
3 Ga0065707_10087720 3300005295 Bacteria 4894
4 Ga0070687_100056662 3300005343 Bacteria 2051
5 Ga0070708_100044090 3300005445 Bacteria 3921
6 Ga0070708_100263000 3300005445 Unclassified 1622
7 Ga0068864_100234523 3300005618 Bacteria 1698
8 Ga0081455_10003236 3300005937 Bacteria 18868
9 Ga0081538_10002037 3300005981 Bacteria 20205
10 Ga0081538_10020578 3300005981 Bacteria 4848
11 Ga0075363_100089870 3300006048 Bacteria 1689
12 Ga0075364_10155376 3300006051 Unclassified 1543
13 Ga0075362_10091040 3300006177 Bacteria 1416
14 Ga0075367_10278650 3300006178 Bacteria 1051
15 Ga0075428_100009121 3300006844 Bacteria 11009
16 Ga0075428_100227716 3300006844 Bacteria 2012
17 Ga0075430_100457864 3300006846 Bacteria 1053
18 Ga0075429_100060305 3300006880 Bacteria 3305
19 Ga0075429_100344572 3300006880 Unclassified 1304
20 Ga0114129_10003837 3300009147 Bacteria 21182
21 Ga0163162_10488646 3300013306 Bacteria 1362
22 Ga0207684_10328596 3300025910 Bacteria 1317
23 Ga0207659_10574150 3300025926 Bacteria 960
24 Ga0207706_10182135 3300025933 Bacteria 1845
25 Ga0207683_10020734 3300026121 Bacteria 5624
26 Ga0209588_1014407 3300027671 Unclassified 2420
27 Ga0265327_10005219 3300031251 Bacteria 10955
28 Ga0316575_10030834 3300031665 Bacteria 2097
29 Ga0316579_10044754 3300031691 Bacteria 2062
30 Ga0316579_10060383 3300031691 Bacteria 1783
31 Ga0316576_10008727 3300031727 Bacteria 6489
32 Ga0316576_10018921 3300031727 Bacteria 4711
33 Ga0316576_10029724 3300031727 Bacteria 3865
34 Ga0316576_10044867 3300031727 Bacteria 3195
35 Ga0316576_10089108 3300031727 Bacteria 2297
36 Ga0316576_10147101 3300031727 Bacteria 1775
37 Ga0316578_10092187 3300031728 Bacteria 1810
38 Ga0316578_10146271 3300031728 Bacteria 1423
39 Ga0316578_10154574 3300031728 Unclassified 1382
40 Ga0316578_10200380 3300031728 Bacteria 1202
41 Ga0316578_10223313 3300031728 Bacteria 1132
42 Ga0316578_10232352 3300031728 Unclassified 1107
43 Ga0316577_10004480 3300031733 Bacteria 7212
44 Ga0316577_10018735 3300031733 Bacteria 3830
45 Ga0316577_10182395 3300031733 Unclassified 1186
46 Ga0316577_10187496 3300031733 Bacteria 1169
47 Ga0316577_10192336 3300031733 Bacteria 1153
48 Ga0316583_10004505 3300032133 Bacteria 4971
49 Ga0316583_10028924 3300032133 Unclassified 1976
50 Ga0316583_10030306 3300032133 Bacteria 1926
51 Ga0316583_10056315 3300032133 Unclassified 1381
52 Ga0316585_10006116 3300032137 Bacteria 3429
53 Ga0316585_10009672 3300032137 Unclassified 2819
54 Ga0316585_10048620 3300032137 Unclassified 1359
55 Ga0316580_10003257 3300032139 Unclassified 4586
56 Ga0316580_10011568 3300032139 Bacteria 2680
57 Ga0316592_1002243 3300033524 Bacteria 3305
58 Ga0316592_1027681 3300033524 Bacteria 1226
59 Ga0373923_0025249 3300035111 Bacteria 2353
60 Ga0316574_0004707 3300035398 Bacteria 7195
61 Ga0316574_0009168 3300035398 Bacteria 5530
62 Ga0316574_0034670 3300035398 Bacteria 3078
63 Ga0316574_0037667 3300035398 Bacteria 2966
64 Ga0316574_0198659 3300035398 Bacteria 1288
65 Ga0373937_0073884 3300036401 Bacteria 3146
66 Ga0316582_0033965 3300036647 Bacteria 3137
67 Ga0316582_0062372 3300036647 Unclassified 2393
68 Ga0316582_0090850 3300036647 Bacteria 2009
69 Ga0316582_0317476 3300036647 Bacteria 1071
70 Ga0316584_0005525 3300036712 Bacteria 8496
71 Ga0316584_0009595 3300036712 Bacteria 6726
72 Ga0316584_0022671 3300036712 Bacteria 4582
73 Ga0316584_0090548 3300036712 Bacteria 2290
74 Ga0316584_0090602 3300036712 Bacteria 2289
75 Ga0316584_0096981 3300036712 Bacteria 2207
76 Ga0316584_0171281 3300036712 Bacteria 1610
77 Ga0316584_0332612 3300036712 Unclassified 1093
78 Ga0316584_0415268 3300036712 Unclassified 956
79 Ga0395900_0457721 3300037418 Bacteria 1231
80 Ga0395901_0178370 3300038443 Bacteria 2228
81 Ga0242422_03742 3300038699 Bacteria 983
82 Ga0237819_03002 3300038705 Bacteria 3140
83 Ga0400484_35453 3300038725 Bacteria 6313
84 Ga0400490_39791 3300038726 Bacteria 31420
85 Ga0400486_03817 3300038742 Unclassified 1511
86 Ga0400483_204697 3300039062 Bacteria 3601
87 Ga0400489_37998 3300039093 Bacteria 17090
88 Ga0400487_14277 3300039110 Bacteria 29430
89 Ga0451577_0047112 3300042876 Unclassified 3855
90 Ga0451577_0218131 3300042876 Bacteria 1724
91 Ga0451577_0314905 3300042876 Unclassified 1419
92 Ga0451577_0334629 3300042876 Bacteria 1373
93 Ga0453683_0049008 3300044673 Bacteria 2648
94 Ga0453683_0062405 3300044673 Unclassified 2330
95 Ga0453683_0166939 3300044673 Bacteria 1394
96 Ga0453684_0004292 3300044712 Bacteria 30397
97 Ga0453684_0005532 3300044712 Bacteria 24935
98 Ga0453684_0012151 3300044712 Bacteria 14284
99 Ga0453684_0013393 3300044712 Bacteria 13326
100 Ga0453684_0014793 3300044712 Bacteria 12433
101 Ga0453684_0020470 3300044712 Bacteria 9974
102 Ga0453684_0113295 3300044712 Unclassified 3290
103 Ga0453684_0142031 3300044712 Bacteria 2865
104 Ga0453684_0209459 3300044712 Bacteria 2267
105 Ga0453684_0547099 3300044712 Unclassified 1276
106 Ga0451576_0089738 3300045051 Bacteria 3197
107 Ga0451576_0430178 3300045051 Bacteria 1385
108 Ga0501040_0166523 3300049576 Unclassified 1560
109 Ga0501041_0211007 3300049577 Unclassified 1218
110 Ga0501042_0183921 3300049578 Bacteria 1508
111 Ga0501068_0183467 3300049584 Bacteria 1324
112 Ga0501071_0162628 3300049587 Bacteria 1669
113 Ga0501071_0438905 3300049587 Bacteria 999
114 Ga0501072_0045960 3300049588 Bacteria 3435
115 Ga0501075_0059754 3300049591 Bacteria 2872
116 Ga0501075_0217786 3300049591 Unclassified 1456
117 Ga0501076_0010538 3300049592 Bacteria 6861
118 Ga0501076_0366562 3300049592 Unclassified 1184
119 Ga0501257_000906 3300049686 Bacteria 5997
120 Ga0501079_0179493 3300049741 Bacteria 1652
121 Ga0501079_0443587 3300049741 Bacteria 1019
122 Ga0501081_0248239 3300049743 Bacteria 1299
123 Ga0501045_0035709 3300049824 Bacteria 3609
124 Ga0501045_0134576 3300049824 Unclassified 1838
125 nmdc:mga00v17_79538_c1 3300050491 Unclassified 2044
126 nmdc:mga07m45_102828_c1 3300050496 Bacteria 1641
127 nmdc:mga05p37_2891_c1 3300050507 Bacteria 19917
128 nmdc:mga09592_413756_c1 3300050508 Unclassified 1165
129 nmdc:mga09592_8143_c1 3300050508 Bacteria 8523
130 nmdc:mga0qj67_233484_c1 3300050509 Bacteria 1492
131 nmdc:mga0qj67_369759_c1 3300050509 Bacteria 1158
132 nmdc:mga06r32_544333_c1 3300050510 Bacteria 1135
133 nmdc:mga06r32_548358_c1 3300050510 Bacteria 1130
134 nmdc:mga06r32_758141_c1 3300050510 Unclassified 933
135 Ga0500616_0003249 3300053153 Bacteria 12580
136 Ga0501084_0143129 3300054114 Bacteria 2014
137 Ga0501082_0155419 3300060353 Bacteria 1987
138 Ga0501082_0289928 3300060353 Viruses 1425
139 Ga0530510_0065197 3300061734 Unclassified 2639
140 2617918829 2617270889 Bacteria 9064343
141 2831429585 2831426010 Bacteria 8662725
142 2848702380 2848694841 Bacteria 9205737
143 2849665829 2849660919 Bacteria 8251853
144 2886630568 2886627955 Bacteria 7618130
145 2913851217 2913844669 Bacteria 8381711
146 2913917378 2913912277 Bacteria 9037797
147 2913940644 2913939268 Bacteria 8559644
148 642601598 642555144 Bacteria 9059191
149 Ga0501080_0306530
150 JGI25405J52794_10002222
151 Ga0065707_10087720
152 Ga0070687_100056662
153 Ga0070708_100044090
154 Ga0070708_100263000
155 Ga0068864_100234523
156 Ga0081455_10003236
157 Ga0081538_10002037
158 Ga0081538_10020578
159 Ga0075363_100089870
160 Ga0075364_10155376
161 Ga0075362_10091040
162 Ga0075367_10278650
163 Ga0075428_100009121
164 Ga0075428_100227716
165 Ga0075430_100457864
166 Ga0075429_100060305
167 Ga0075429_100344572
168 Ga0114129_10003837
169 Ga0163162_10488646
170 Ga0207684_10328596
171 Ga0207659_10574150
172 Ga0207706_10182135
173 Ga0207683_10020734
174 Ga0209588_1014407
175 Ga0265327_10005219
176 Ga0316575_10030834
177 Ga0316579_10044754
178 Ga0316579_10060383
179 Ga0316576_10008727
180 Ga0316576_10018921
181 Ga0316576_10029724
182 Ga0316576_10044867
183 Ga0316576_10089108
184 Ga0316576_10147101
185 Ga0316578_10092187
186 Ga0316578_10146271
187 Ga0316578_10154574
188 Ga0316578_10200380
189 Ga0316578_10223313
190 Ga0316578_10232352
191 Ga0316577_10004480
192 Ga0316577_10018735
193 Ga0316577_10182395
194 Ga0316577_10187496
195 Ga0316577_10192336
196 Ga0316583_10004505
197 Ga0316583_10028924
198 Ga0316583_10030306
199 Ga0316583_10056315
200 Ga0316585_10006116
201 Ga0316585_10009672
202 Ga0316585_10048620
203 Ga0316580_10003257
204 Ga0316580_10011568
205 Ga0316592_1002243
206 Ga0316592_1027681
207 Ga0373923_0025249
208 Ga0316574_0004707
209 Ga0316574_0009168
210 Ga0316574_0034670
211 Ga0316574_0037667
212 Ga0316574_0198659
213 Ga0373937_0073884
214 Ga0316582_0033965
215 Ga0316582_0062372
216 Ga0316582_0090850
217 Ga0316582_0317476
218 Ga0316584_0005525
219 Ga0316584_0009595
220 Ga0316584_0022671
221 Ga0316584_0090548
222 Ga0316584_0090602
223 Ga0316584_0096981
224 Ga0316584_0171281
225 Ga0316584_0332612
226 Ga0316584_0415268
227 Ga0395900_0457721
228 Ga0395901_0178370
229 Ga0242422_03742
230 Ga0237819_03002
231 Ga0400484_35453
232 Ga0400490_39791
233 Ga0400486_03817
234 Ga0400483_204697
235 Ga0400489_37998
236 Ga0400487_14277
237 Ga0451577_0047112
238 Ga0451577_0218131
239 Ga0451577_0314905
240 Ga0451577_0334629
241 Ga0453683_0049008
242 Ga0453683_0062405
243 Ga0453683_0166939
244 Ga0453684_0004292
245 Ga0453684_0005532
246 Ga0453684_0012151
247 Ga0453684_0013393
248 Ga0453684_0014793
249 Ga0453684_0020470
250 Ga0453684_0113295
251 Ga0453684_0142031
252 Ga0453684_0209459
253 Ga0453684_0547099
254 Ga0451576_0089738
255 Ga0451576_0430178
256 Ga0501040_0166523
257 Ga0501041_0211007
258 Ga0501042_0183921
259 Ga0501068_0183467
260 Ga0501071_0162628
261 Ga0501071_0438905
262 Ga0501072_0045960
263 Ga0501075_0059754
264 Ga0501075_0217786
265 Ga0501076_0010538
266 Ga0501076_0366562
267 Ga0501257_000906
268 Ga0501079_0179493
269 Ga0501079_0443587
270 Ga0501081_0248239
271 Ga0501045_0035709
272 Ga0501045_0134576
273 nmdc:mga00v17_79538_c1
274 nmdc:mga07m45_102828_c1
275 nmdc:mga05p37_2891_c1
276 nmdc:mga09592_413756_c1
277 nmdc:mga09592_8143_c1
278 nmdc:mga0qj67_233484_c1
279 nmdc:mga0qj67_369759_c1
280 nmdc:mga06r32_544333_c1
281 nmdc:mga06r32_548358_c1
282 nmdc:mga06r32_758141_c1
283 Ga0500616_0003249
284 Ga0501084_0143129
285 Ga0501082_0155419
286 Ga0501082_0289928
287 Ga0530510_0065197
288 2617918829
289 2831429585
290 2848702380
291 2849665829
292 2886630568
293 2913851217
294 2913917378
295 2913940644
296 642601598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5up0-assembly1.cif.gz_A crystal structure of human pde1b catalytic domain in complex with inhibitor 3 (6-(4-chlorobenzyl)-8,9,10,11-tetrahydrobenzo[4,5]thieno[3,2-e][1,2,4]triazolo[1,5-c]pyrimidin-5(6h)-one) 0.5977 9 274
4npv-assembly1.cif.gz_A crystal structure of human pde1b bound to inhibitor 7a (6,7,8-trimethoxy-n-(pentan-3-yl)quinazolin-4-amine) 0.596 9 272
5up0-assembly1.cif.gz_A crystal structure of human pde1b catalytic domain in complex with inhibitor 3 (6-(4-chlorobenzyl)-8,9,10,11-tetrahydrobenzo[4,5]thieno[3,2-e][1,2,4]triazolo[1,5-c]pyrimidin-5(6h)-one) 0.5765 9 274
6acb-assembly1.cif.gz_A crystal structure of pde5 in complex with inhibitor lw1805 0.5747 2 273
3shy-assembly1.cif.gz_A crystal structure of the pde5a1 catalytic domain in complex with novel inhibitors 0.5737 2 273
ID Description Score Start End Superfamily
4npwA00 Mainly Alpha;Orthogonal Bundle;Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b;3'5'-cyclic nucleotide phosphodiesterase, catalytic domain 0.5949 9 272 1.10.1300.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5907 38 208 1.10.3210.10
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.577 36 212 1.10.3210.10
4npwA00 Mainly Alpha;Orthogonal Bundle;Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b;3'5'-cyclic nucleotide phosphodiesterase, catalytic domain 0.5702 9 272 1.10.1300.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5631 38 208 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A6P0Z550-F1-model_v4 Metal-dependent phosphohydrolase 0.9972 39 272 GO:0016787
AF-A0A3B0V990-F1-model_v4 Metal-dependent phosphohydrolase 0.9928 1 190
AF-A0A6P0WV95-F1-model_v4 Metal-dependent phosphohydrolase 0.9919 1 272 GO:0016787
AF-K9WGZ8-F1-model_v4 Metal-dependent phosphohydrolase 0.9918 1 271
AF-A0A529L5K9-F1-model_v4 Metal-dependent phosphohydrolase 0.9911 41 271 GO:0016787

Map