F202533

General Info

Members Datasets Scaffolds Average Seq Length
148 114 296 188

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100002753|Ga0070678_1000027535
Length 190
Sequence MSAVDLPPGIGLQGTPLGLFRPPAGSRRLATASLVIVVAFGALTWAAVSRHPYRYHASTQVILPVAFAAVALLGFAVRRAQLAITRDGVRWGWDAFSFTQQASRIVTAHAYADGVALVSKRGSTSSWFLAARDWERYDAIIRQMRRAELPVQEHAGKAPLRARLQSYGRFLDALLVGAIAGAFAVMLWSA

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
64 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
65 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
66 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
69 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
84 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
85 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
89 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
90 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
91 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
98 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
99 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
100 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
101 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
102 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
103 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
104 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
105 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
106 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
107 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
108 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
109 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
110 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
111 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
112 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
113 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.19
Nodule 0
Rhizoplane 0.68
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 14.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100002753 3300005456 Bacteria 9715
2 rootH2_10248384 3300003320 Bacteria 1156
3 Ga0070658_10061640 3300005327 Bacteria 3056
4 Ga0070683_100374024 3300005329 Bacteria 1357
5 Ga0070690_100014207 3300005330 Bacteria 4721
6 Ga0068869_100269347 3300005334 Bacteria 1366
7 Ga0070689_100055479 3300005340 Bacteria 3071
8 Ga0070689_100298282 3300005340 Bacteria 1341
9 Ga0070689_101159009 3300005340 Unclassified 692
10 Ga0070688_100177381 3300005365 Unclassified 1475
11 Ga0070688_100455135 3300005365 Unclassified 958
12 Ga0070701_10033858 3300005438 Bacteria 2556
13 Ga0070700_100499969 3300005441 Bacteria 935
14 Ga0070700_101058737 3300005441 Bacteria 670
15 Ga0070694_100237695 3300005444 Bacteria 1373
16 Ga0070708_100431295 3300005445 Bacteria 1243
17 Ga0070681_10845352 3300005458 Bacteria 833
18 Ga0070685_10204741 3300005466 Bacteria 1285
19 Ga0070706_100142705 3300005467 Unclassified 2235
20 Ga0070698_100002425 3300005471 Bacteria 20545
21 Ga0070698_100202567 3300005471 Bacteria 1920
22 Ga0070679_100095440 3300005530 Bacteria 2961
23 Ga0070679_100477389 3300005530 Bacteria 1191
24 Ga0070684_100244670 3300005535 Bacteria 1639
25 Ga0070684_100647274 3300005535 Bacteria 984
26 Ga0070695_100236530 3300005545 Bacteria 1323
27 Ga0068857_100036165 3300005577 Bacteria 4375
28 Ga0068856_100025691 3300005614 Bacteria 5742
29 Ga0068852_100522994 3300005616 Bacteria 1184
30 Ga0068859_100213803 3300005617 Bacteria 2015
31 Ga0068864_100111988 3300005618 Bacteria 2432
32 Ga0068864_100581725 3300005618 Bacteria 1085
33 Ga0068866_10135147 3300005718 Bacteria 1408
34 Ga0068870_10164765 3300005840 Unclassified 1318
35 Ga0068863_100130956 3300005841 Bacteria 2395
36 Ga0068860_100085420 3300005843 Bacteria 3003
37 Ga0068860_100460573 3300005843 Archaea 1265
38 Ga0070717_10012331 3300006028 Bacteria 6514
39 Ga0070717_10047289 3300006028 Bacteria 3524
40 Ga0075429_100440637 3300006880 Bacteria 1141
41 Ga0097620_100213818 3300006931 Bacteria 2015
42 Ga0075435_100040161 3300007076 Bacteria 3735
43 Ga0105245_10000047 3300009098 Bacteria 131670
44 Ga0105245_10440804 3300009098 Bacteria 1309
45 Ga0105245_10451433 3300009098 Bacteria 1294
46 Ga0105249_10025553 3300009553 Bacteria 5317
47 Ga0213876_10109196 3300021384 Bacteria 1468
48 Ga0207684_10116929 3300025910 Unclassified 2285
49 Ga0207662_10377517 3300025918 Bacteria 957
50 Ga0207652_10168890 3300025921 Bacteria 1962
51 Ga0207646_10588540 3300025922 Bacteria 999
52 Ga0207687_10034711 3300025927 Bacteria 3426
53 Ga0207670_10268319 3300025936 Unclassified 1326
54 Ga0207670_10546972 3300025936 Bacteria 945
55 Ga0207689_10306382 3300025942 Bacteria 1317
56 Ga0207689_10502663 3300025942 Bacteria 1016
57 Ga0207661_10313913 3300025944 Bacteria 1408
58 Ga0207712_10019377 3300025961 Bacteria 4442
59 Ga0207677_10130042 3300026023 Bacteria 1910
60 Ga0207708_10458314 3300026075 Unclassified 1063
61 Ga0207708_10863061 3300026075 Bacteria 782
62 Ga0207702_10993981 3300026078 Bacteria 832
63 Ga0207641_10060557 3300026088 Bacteria 3227
64 Ga0207676_10651541 3300026095 Bacteria 1016
65 Ga0207674_10033797 3300026116 Bacteria 5351
66 Ga0268264_10088664 3300028381 Bacteria 2663
67 Ga0268264_11112062 3300028381 Bacteria 799
68 Ga0307517_10042718 3300028786 Bacteria 4852
69 Ga0307515_10003997 3300028794 Bacteria 30775
70 Ga0265338_10087328 3300028800 Bacteria 2591
71 Ga0265332_10134087 3300031238 Bacteria 1038
72 Ga0265331_10213863 3300031250 Bacteria 867
73 Ga0307513_10043939 3300031456 Bacteria 4900
74 Ga0307513_10193617 3300031456 Bacteria 1882
75 Ga0307509_10001121 3300031507 Bacteria 45933
76 Ga0307509_10004114 3300031507 Bacteria 21275
77 Ga0307509_10077498 3300031507 Bacteria 3447
78 Ga0265313_10105484 3300031595 Bacteria 1245
79 Ga0307508_10012206 3300031616 Bacteria 7855
80 Ga0307508_10459021 3300031616 Bacteria 867
81 Ga0307516_10007933 3300031730 Bacteria 12090
82 Ga0307406_10018545 3300031901 Bacteria 4067
83 Ga0307406_10729925 3300031901 Bacteria 830
84 Ga0307507_10137596 3300033179 Bacteria 1885
85 Ga0373949_0000318 3300035090 Bacteria 17120
86 Ga0373936_0000006 3300035113 Bacteria 318697
87 Ga0373941_0102495 3300035115 Bacteria 998
88 Ga0373956_0025219 3300035119 Bacteria 2568
89 Ga0373960_0187812 3300035121 Bacteria 725
90 Ga0373961_0000127 3300035241 Bacteria 38962
91 Ga0395899_0048583 3300037312 Bacteria 3157
92 Ga0395900_0025736 3300037418 Bacteria 6022
93 Ga0395900_1006130 3300037418 Bacteria 753
94 Ga0395898_0211449 3300037466 Bacteria 1850
95 Ga0395905_0196858 3300037471 Bacteria 1890
96 Ga0395905_0326224 3300037471 Bacteria 1425
97 Ga0395901_0120391 3300038443 Bacteria 2758
98 Ga0395901_0277016 3300038443 Unclassified 1744
99 Ga0436365_1318659 3300039437 Bacteria 8068
100 Ga0436365_1738541 3300039437 Bacteria 1470
101 Ga0451793_1420053 3300041452 Bacteria 1176
102 Ga0451577_0385284 3300042876 Bacteria 1272
103 Ga0495622_0105842 3300046557 Bacteria 1289
104 Ga0501033_0322633 3300049570 Unclassified 1085
105 Ga0501034_0461463 3300049571 Bacteria 1187
106 Ga0501043_0256207 3300049579 Bacteria 1347
107 Ga0501047_0047645 3300049581 Bacteria 4140
108 Ga0501067_0096149 3300049583 Unclassified 1645
109 Ga0501068_0067428 3300049584 Bacteria 2181
110 Ga0501069_0248734 3300049585 Unclassified 1037
111 Ga0501070_0032080 3300049586 Bacteria 4398
112 Ga0501070_0071472 3300049586 Bacteria 2873
113 Ga0501070_0200265 3300049586 Bacteria 1640
114 Ga0501070_0565012 3300049586 Unclassified 909
115 Ga0501070_0637895 3300049586 Bacteria 846
116 Ga0501072_0322944 3300049588 Unclassified 1227
117 Ga0501227_009400 3300049665 Bacteria 2106
118 Ga0501230_000081 3300049667 Bacteria 6510
119 Ga0501233_006918 3300049668 Bacteria 2146
120 Ga0501229_000588 3300049706 Bacteria 4078
121 Ga0501079_0574398 3300049741 Unclassified 887
122 Ga0501080_0202381 3300049742 Bacteria 1823
123 Ga0501044_0077871 3300049823 Bacteria 3361
124 nmdc:mga09592_48883_c1 3300050508 Bacteria 3566
125 nmdc:mga0n895_585402_c1 3300050512 Bacteria 1119
126 nmdc:mga0rr50_46409_c1 3300050513 Bacteria 3198
127 Ga0500635_0032908 3300053080 Bacteria 1688
128 Ga0500646_0003117 3300053090 Unclassified 4252
129 Ga0500566_0000876 3300053094 Bacteria 17176
130 Ga0500566_0003331 3300053094 Bacteria 9607
131 Ga0500566_0044771 3300053094 Bacteria 2549
132 Ga0500640_000329 3300053095 Bacteria 10938
133 Ga0500554_000065 3300053102 Bacteria 19001
134 Ga0500554_063474 3300053102 Bacteria 1190
135 Ga0500595_001044 3300053119 Bacteria 15429
136 Ga0500614_001281 3300053123 Bacteria 6072
137 Ga0500614_004699 3300053123 Bacteria 2871
138 Ga0500642_0184866 3300053130 Bacteria 973
139 Ga0500559_0005839 3300053136 Bacteria 5611
140 Ga0500564_109140 3300053138 Unclassified 1216
141 Ga0500603_005258 3300053150 Bacteria 2779
142 Ga0500630_119053 3300053159 Unclassified 1173
143 Ga0500636_0176951 3300053177 Bacteria 1149
144 Ga0500636_0210505 3300053177 Bacteria 1021
145 Ga0500637_0064598 3300053178 Bacteria 2100
146 Ga0500601_008808 3300053737 Unclassified 1124
147 Ga0500661_049510 3300055283 Unclassified 750
148 Ga0501082_0218114 3300060353 Unclassified 1660
149 Ga0070678_100002753
150 rootH2_10248384
151 Ga0070658_10061640
152 Ga0070683_100374024
153 Ga0070690_100014207
154 Ga0068869_100269347
155 Ga0070689_100055479
156 Ga0070689_100298282
157 Ga0070689_101159009
158 Ga0070688_100177381
159 Ga0070688_100455135
160 Ga0070701_10033858
161 Ga0070700_100499969
162 Ga0070700_101058737
163 Ga0070694_100237695
164 Ga0070708_100431295
165 Ga0070681_10845352
166 Ga0070685_10204741
167 Ga0070706_100142705
168 Ga0070698_100002425
169 Ga0070698_100202567
170 Ga0070679_100095440
171 Ga0070679_100477389
172 Ga0070684_100244670
173 Ga0070684_100647274
174 Ga0070695_100236530
175 Ga0068857_100036165
176 Ga0068856_100025691
177 Ga0068852_100522994
178 Ga0068859_100213803
179 Ga0068864_100111988
180 Ga0068864_100581725
181 Ga0068866_10135147
182 Ga0068870_10164765
183 Ga0068863_100130956
184 Ga0068860_100085420
185 Ga0068860_100460573
186 Ga0070717_10012331
187 Ga0070717_10047289
188 Ga0075429_100440637
189 Ga0097620_100213818
190 Ga0075435_100040161
191 Ga0105245_10000047
192 Ga0105245_10440804
193 Ga0105245_10451433
194 Ga0105249_10025553
195 Ga0213876_10109196
196 Ga0207684_10116929
197 Ga0207662_10377517
198 Ga0207652_10168890
199 Ga0207646_10588540
200 Ga0207687_10034711
201 Ga0207670_10268319
202 Ga0207670_10546972
203 Ga0207689_10306382
204 Ga0207689_10502663
205 Ga0207661_10313913
206 Ga0207712_10019377
207 Ga0207677_10130042
208 Ga0207708_10458314
209 Ga0207708_10863061
210 Ga0207702_10993981
211 Ga0207641_10060557
212 Ga0207676_10651541
213 Ga0207674_10033797
214 Ga0268264_10088664
215 Ga0268264_11112062
216 Ga0307517_10042718
217 Ga0307515_10003997
218 Ga0265338_10087328
219 Ga0265332_10134087
220 Ga0265331_10213863
221 Ga0307513_10043939
222 Ga0307513_10193617
223 Ga0307509_10001121
224 Ga0307509_10004114
225 Ga0307509_10077498
226 Ga0265313_10105484
227 Ga0307508_10012206
228 Ga0307508_10459021
229 Ga0307516_10007933
230 Ga0307406_10018545
231 Ga0307406_10729925
232 Ga0307507_10137596
233 Ga0373949_0000318
234 Ga0373936_0000006
235 Ga0373941_0102495
236 Ga0373956_0025219
237 Ga0373960_0187812
238 Ga0373961_0000127
239 Ga0395899_0048583
240 Ga0395900_0025736
241 Ga0395900_1006130
242 Ga0395898_0211449
243 Ga0395905_0196858
244 Ga0395905_0326224
245 Ga0395901_0120391
246 Ga0395901_0277016
247 Ga0436365_1318659
248 Ga0436365_1738541
249 Ga0451793_1420053
250 Ga0451577_0385284
251 Ga0495622_0105842
252 Ga0501033_0322633
253 Ga0501034_0461463
254 Ga0501043_0256207
255 Ga0501047_0047645
256 Ga0501067_0096149
257 Ga0501068_0067428
258 Ga0501069_0248734
259 Ga0501070_0032080
260 Ga0501070_0071472
261 Ga0501070_0200265
262 Ga0501070_0565012
263 Ga0501070_0637895
264 Ga0501072_0322944
265 Ga0501227_009400
266 Ga0501230_000081
267 Ga0501233_006918
268 Ga0501229_000588
269 Ga0501079_0574398
270 Ga0501080_0202381
271 Ga0501044_0077871
272 nmdc:mga09592_48883_c1
273 nmdc:mga0n895_585402_c1
274 nmdc:mga0rr50_46409_c1
275 Ga0500635_0032908
276 Ga0500646_0003117
277 Ga0500566_0000876
278 Ga0500566_0003331
279 Ga0500566_0044771
280 Ga0500640_000329
281 Ga0500554_000065
282 Ga0500554_063474
283 Ga0500595_001044
284 Ga0500614_001281
285 Ga0500614_004699
286 Ga0500642_0184866
287 Ga0500559_0005839
288 Ga0500564_109140
289 Ga0500603_005258
290 Ga0500630_119053
291 Ga0500636_0176951
292 Ga0500636_0210505
293 Ga0500637_0064598
294 Ga0500601_008808
295 Ga0500661_049510
296 Ga0501082_0218114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zdn-assembly1.cif.gz_A d11-c mutant of monoamine oxidase from aspergillus niger 0.8584 100 121
3zdn-assembly1.cif.gz_B d11-c mutant of monoamine oxidase from aspergillus niger 0.8574 100 121
2vvm-assembly1.cif.gz_A the structure of mao-n-d5, a variant of monoamine oxidase from aspergillus niger. 0.8497 100 121
8eei-assembly1.cif.gz_A unbound c. ammoniagenes monoamine oxidase (mao) 0.8334 100 121
2vvm-assembly1.cif.gz_B the structure of mao-n-d5, a variant of monoamine oxidase from aspergillus niger. 0.8257 100 121
ID Description Score Start End Superfamily
1sj8A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.8659 20 70 1.20.120.230
af_K7LKV5_39_184_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.8601 21 70 1.20.140.40
af_Q9Y490_661_785_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.8528 20 70 1.20.120.230
af_Q9STY3_82_242_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.8476 20 74 1.20.140.40
af_I1JKR8_24_176_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.8465 20 70 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A7W0VWE4-F1-model_v4 PH domain-containing protein 0.9307 1 183 GO:0016020
AF-A0A7W0VWE4-F1-model_v4 PH domain-containing protein 0.9258 1 183 GO:0016020
AF-A0A7W0VJG1-F1-model_v4 Uncharacterized protein 0.9194 58 183
AF-A0A7W0VJG1-F1-model_v4 Uncharacterized protein 0.906 58 183
AF-A0A1N7R158-F1-model_v4 PH domain-containing protein 0.8126 13 146 GO:0016020

Map