F200821

General Info

Members Datasets Scaffolds Average Seq Length
147 125 294 297

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10026866|Ga0316576_100268662
Length 338
Sequence LGRYVIRRVLQFIPVFFASTFIIFYLVFALPGDPIKALGGEKQLPDSVYNALVDRYNMDDPLLVQYGKYIGVLRDSDPSCTDDPELRKQINRGEAPEEVCFNGVLQGDFGESFSRRDVSEILKQKVPTTAKLALMAFVFELVIGITAGVLAGLRRGSFIDNLVLVATTAIISIPVFVLGYAAQLIIGVRLGWLPVSASSGDFKSLLLPAMVLGSVSLAYVARLTRTSLVENLRADYVRTATSKGLPRRRVIGKHALRNSLIPVITYLGIDLGALMGGAIITEGIFNVPGIGTEVFRAVRQQEGAVVVGIVTFLVLVYMITTLIVDILYAVLDPRIRYD

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
12 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
13 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
16 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
17 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
20 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
21 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
22 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
23 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
24 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
25 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
26 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
27 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
28 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
29 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
30 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
31 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
34 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
35 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
36 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
37 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
38 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
39 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
40 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
41 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
42 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
43 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
44 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
45 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
46 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
47 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
48 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
49 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
61 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
62 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
63 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
64 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
65 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
66 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
67 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
68 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
69 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
70 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
71 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
72 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
77 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
78 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
79 2643221546 Microbacterium sp. Root53 Isolate Unclassified
80 2643221549 Agromyces sp. Root1464 Isolate Unclassified
81 2643221649 Leifsonia sp. Root4 Isolate Unclassified
82 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
83 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
84 2773857759 Microbacterium sp. 1294 Isolate Unclassified
85 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
86 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
87 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
88 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
89 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
90 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
91 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
92 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
93 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
94 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
95 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
96 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
97 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
98 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
99 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
100 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
101 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
102 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
103 2919069694 Microbacterium sp. 1154 Isolate Unclassified
104 2919395869 Microbacterium resistens 2980 Isolate Unclassified
105 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
106 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
107 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
108 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
109 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
110 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
111 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
112 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
113 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
114 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
115 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
116 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
117 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
118 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
119 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
120 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
121 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
122 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
123 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
124 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
125 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 59.18
Metatranscriptomes 6.8
Isolates 34.01

Biome Distribution

Category Percentage (%)
Aerial Root 2.04
Bulb 0
Endosphere 10.2
Nodule 0
Rhizoplane 1.36
Rhizosphere 59.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10026866 3300031727 Bacteria 4043
2 rootH1_10304006 3300003323 Bacteria 1500
3 Ga0065714_10067205 3300005288 Bacteria 5775
4 Ga0065714_10082355 3300005288 Bacteria 2310
5 Ga0065714_10130959 3300005288 Bacteria 1251
6 Ga0070670_100340080 3300005331 Bacteria 1317
7 Ga0070660_100245443 3300005339 Bacteria 1459
8 Ga0070671_100091174 3300005355 Bacteria 2552
9 Ga0068857_100174435 3300005577 Bacteria 1955
10 Ga0075365_10073014 3300006038 Bacteria 2312
11 Ga0075364_10084843 3300006051 Bacteria 2097
12 Ga0075367_10070624 3300006178 Bacteria 2099
13 Ga0075367_10251231 3300006178 Bacteria 1109
14 Ga0105249_10146919 3300009553 Bacteria 2266
15 Ga0105246_10088035 3300011119 Bacteria 2230
16 Ga0157371_10005706 3300013102 Bacteria 10435
17 Ga0157371_10064688 3300013102 Bacteria 2591
18 Ga0157369_10000455 3300013105 Bacteria 54224
19 Ga0157375_10478724 3300013308 Bacteria 1410
20 Ga0209646_1000092 3300025246 Bacteria 185930
21 Ga0207647_10010588 3300025904 Bacteria 6504
22 Ga0268266_10351659 3300028379 Bacteria 1385
23 Ga0265327_10000004 3300031251 Bacteria 803973
24 Ga0307514_10007020 3300031649 Bacteria 9727
25 Ga0316575_10000033 3300031665 Bacteria 33178
26 Ga0307413_10062660 3300031824 Bacteria 2302
27 Ga0307410_10033288 3300031852 Bacteria 3326
28 Ga0307406_10020988 3300031901 Bacteria 3858
29 Ga0307407_10087617 3300031903 Bacteria 1900
30 Ga0307412_10071488 3300031911 Bacteria 2369
31 Ga0307412_10156168 3300031911 Bacteria 1689
32 Ga0307409_100011178 3300031995 Bacteria 5641
33 Ga0307409_100078362 3300031995 Bacteria 2658
34 Ga0307409_100203973 3300031995 Bacteria 1771
35 Ga0307416_100731554 3300032002 Bacteria 1081
36 Ga0307414_10118458 3300032004 Bacteria 2031
37 Ga0307415_100323406 3300032126 Bacteria 1287
38 Ga0307415_100491758 3300032126 Bacteria 1070
39 Ga0395900_0136133 3300037418 Bacteria 2516
40 Ga0395901_0142549 3300038443 Bacteria 2518
41 Ga0400488_10878 3300038741 Bacteria 2198
42 Ga0400486_13885 3300038742 Bacteria 1187
43 Ga0451789_0482754 3300041443 Bacteria 2520
44 Ga0451793_0731841 3300041452 Bacteria 1693
45 Ga0466968_0051960 3300044735 Bacteria 1752
46 Ga0466970_0003582 3300044765 Bacteria 7570
47 Ga0466970_0064163 3300044765 Bacteria 1969
48 Ga0466970_0276954 3300044765 Bacteria 943
49 Ga0495626_0024401 3300048091 Bacteria 2965
50 Ga0496117_0000120 3300048920 Bacteria 171697
51 Ga0496117_0021937 3300048920 Bacteria 5141
52 Ga0496118_0006123 3300048921 Bacteria 13363
53 Ga0496119_0021200 3300048922 Bacteria 4706
54 Ga0496119_0025842 3300048922 Bacteria 4090
55 Ga0496120_0006115 3300048923 Bacteria 9336
56 Ga0496120_0156751 3300048923 Bacteria 1139
57 Ga0496122_0000059 3300048925 Bacteria 247170
58 Ga0496122_0008914 3300048925 Bacteria 10676
59 Ga0496123_0000013 3300048926 Bacteria 439694
60 Ga0496123_0039474 3300048926 Bacteria 3302
61 Ga0496124_0008848 3300048927 Bacteria 10453
62 Ga0496124_0116720 3300048927 Bacteria 2139
63 Ga0496125_0002149 3300048928 Bacteria 26411
64 Ga0496125_0075152 3300048928 Bacteria 2616
65 Ga0496126_0018532 3300048929 Bacteria 6893
66 Ga0501306_002510 3300049127 Bacteria 1890
67 Ga0501317_000469 3300049533 Bacteria 2830
68 Ga0501318_000277 3300049534 Bacteria 2961
69 Ga0501321_001654 3300049537 Bacteria 1817
70 Ga0501323_002600 3300049539 Bacteria 1768
71 Ga0501325_004525 3300049541 Bacteria 1068
72 Ga0501032_0084691 3300049569 Bacteria 2108
73 Ga0501034_0022708 3300049571 Bacteria 6391
74 Ga0501034_0280988 3300049571 Bacteria 1604
75 Ga0501037_0176493 3300049573 Bacteria 1517
76 Ga0501038_0012910 3300049574 Bacteria 7620
77 Ga0501043_0007698 3300049579 Bacteria 8530
78 Ga0501069_0012170 3300049585 Bacteria 4570
79 Ga0501070_0000414 3300049586 Bacteria 38868
80 Ga0501073_0061033 3300049589 Bacteria 2631
81 Ga0501080_0000056 3300049742 Bacteria 72834
82 Ga0501083_0017558 3300049744 Bacteria 4987
83 nmdc:mga00v17_6031_c1 3300050491 Bacteria 6411
84 nmdc:mga00v17_90965_c1 3300050491 Bacteria 1916
85 nmdc:mga0yw44_37653_c1 3300050492 Bacteria 2857
86 nmdc:mga0yw44_5983_c1 3300050492 Bacteria 5824
87 nmdc:mga0yw44_95114_c1 3300050492 Bacteria 1889
88 nmdc:mga06z11_244819_c1 3300050494 Bacteria 1054
89 nmdc:mga0sz30_4511_c1 3300050516 Bacteria 5037
90 Ga0500650_0072201 3300053098 Bacteria 1613
91 Ga0500577_0093021 3300053142 Bacteria 1221
92 Ga0500616_0000058 3300053153 Bacteria 266276
93 Ga0500616_0000151 3300053153 Bacteria 116796
94 Ga0587084_000054 3300059477 Bacteria 5364
95 Ga0587077_006291 3300059493 Bacteria 1673
96 Ga0587101_003050 3300059623 Bacteria 1666
97 Ga0587069_005627 3300059642 Bacteria 1468
98 2537898299 2537561592 Bacteria 4348607
99 2555230763 2554235227 Bacteria 3637389
100 2587864421 2585428094 Bacteria 3604039
101 2643752850 2643221546 Bacteria 2910897
102 2643769698 2643221549 Bacteria 4042819
103 2644280393 2643221649 Bacteria 3867359
104 2644382883 2643221669 Bacteria 3611286
105 2655031888 2654587600 Bacteria 3911798
106 2774384116 2773857759 Bacteria 2963774
107 2833712839 2833709550 Bacteria 4008291
108 2844855915 2844852863 Bacteria 3849151
109 2852646746 2852646457 Bacteria 3408613
110 2857721971 2857720070 Bacteria 3189373
111 2857738143 2857737099 Bacteria 3104305
112 2862995232 2862993130 Bacteria 3860849
113 2870622805 2870622029 Bacteria 3643329
114 2895663659 2895660088 Bacteria 3782833
115 2904430980 2904430863 Bacteria 3486923
116 2904500462 2904497146 Bacteria 4731781
117 2904503501 2904501621 Bacteria 3401437
118 2904511614 2904509784 Bacteria 3520416
119 2906803188 2906799679 Bacteria 4031749
120 2908675148 2908674828 Bacteria 3382763
121 2908680546 2908678064 Bacteria 3482747
122 2909075537 2909074476 Bacteria 3436050
123 2919039826 2919039151 Bacteria 3391018
124 2919045933 2919042368 Bacteria 3905917
125 2919071898 2919069694 Bacteria 3622919
126 2919396013 2919395869 Bacteria 3704152
127 2928091768 2928090899 Bacteria 3158267
128 2928503136 2928500415 Bacteria 3384541
129 2935410961 2935409751 Bacteria 4179611
130 2939657199 2939657138 Bacteria 3740283
131 2946034400 2946033335 Bacteria 3835514
132 2966925747 2966924647 Bacteria 3268643
133 2974297563 2974294766 Bacteria 3767688
134 2974326201 2974324384 Bacteria 3750535
135 2977231796 2977228692 Bacteria 3450105
136 2977237154 2977236895 Bacteria 3569373
137 2977254370 2977251589 Bacteria 2952848
138 2977267105 2977264416 Bacteria 3750737
139 2984545057 2984542743 Bacteria 3569378
140 2984553287 2984551494 Bacteria 3877562
141 2984581472 2984580707 Bacteria 3351387
142 2995727077 2995726249 Bacteria 3470435
143 8002813631 8002811521 Bacteria 2942897
144 8055036774 8055034563 Bacteria 3562128
145 8055040792 8055037949 Bacteria 3337834
146 8056039794 8056037122 Bacteria 3854319
147 8057348301 8057345674 Bacteria 4160394
148 Ga0316576_10026866
149 rootH1_10304006
150 Ga0065714_10067205
151 Ga0065714_10082355
152 Ga0065714_10130959
153 Ga0070670_100340080
154 Ga0070660_100245443
155 Ga0070671_100091174
156 Ga0068857_100174435
157 Ga0075365_10073014
158 Ga0075364_10084843
159 Ga0075367_10070624
160 Ga0075367_10251231
161 Ga0105249_10146919
162 Ga0105246_10088035
163 Ga0157371_10005706
164 Ga0157371_10064688
165 Ga0157369_10000455
166 Ga0157375_10478724
167 Ga0209646_1000092
168 Ga0207647_10010588
169 Ga0268266_10351659
170 Ga0265327_10000004
171 Ga0307514_10007020
172 Ga0316575_10000033
173 Ga0307413_10062660
174 Ga0307410_10033288
175 Ga0307406_10020988
176 Ga0307407_10087617
177 Ga0307412_10071488
178 Ga0307412_10156168
179 Ga0307409_100011178
180 Ga0307409_100078362
181 Ga0307409_100203973
182 Ga0307416_100731554
183 Ga0307414_10118458
184 Ga0307415_100323406
185 Ga0307415_100491758
186 Ga0395900_0136133
187 Ga0395901_0142549
188 Ga0400488_10878
189 Ga0400486_13885
190 Ga0451789_0482754
191 Ga0451793_0731841
192 Ga0466968_0051960
193 Ga0466970_0003582
194 Ga0466970_0064163
195 Ga0466970_0276954
196 Ga0495626_0024401
197 Ga0496117_0000120
198 Ga0496117_0021937
199 Ga0496118_0006123
200 Ga0496119_0021200
201 Ga0496119_0025842
202 Ga0496120_0006115
203 Ga0496120_0156751
204 Ga0496122_0000059
205 Ga0496122_0008914
206 Ga0496123_0000013
207 Ga0496123_0039474
208 Ga0496124_0008848
209 Ga0496124_0116720
210 Ga0496125_0002149
211 Ga0496125_0075152
212 Ga0496126_0018532
213 Ga0501306_002510
214 Ga0501317_000469
215 Ga0501318_000277
216 Ga0501321_001654
217 Ga0501323_002600
218 Ga0501325_004525
219 Ga0501032_0084691
220 Ga0501034_0022708
221 Ga0501034_0280988
222 Ga0501037_0176493
223 Ga0501038_0012910
224 Ga0501043_0007698
225 Ga0501069_0012170
226 Ga0501070_0000414
227 Ga0501073_0061033
228 Ga0501080_0000056
229 Ga0501083_0017558
230 nmdc:mga00v17_6031_c1
231 nmdc:mga00v17_90965_c1
232 nmdc:mga0yw44_37653_c1
233 nmdc:mga0yw44_5983_c1
234 nmdc:mga0yw44_95114_c1
235 nmdc:mga06z11_244819_c1
236 nmdc:mga0sz30_4511_c1
237 Ga0500650_0072201
238 Ga0500577_0093021
239 Ga0500616_0000058
240 Ga0500616_0000151
241 Ga0587084_000054
242 Ga0587077_006291
243 Ga0587101_003050
244 Ga0587069_005627
245 2537898299
246 2555230763
247 2587864421
248 2643752850
249 2643769698
250 2644280393
251 2644382883
252 2655031888
253 2774384116
254 2833712839
255 2844855915
256 2852646746
257 2857721971
258 2857738143
259 2862995232
260 2870622805
261 2895663659
262 2904430980
263 2904500462
264 2904503501
265 2904511614
266 2906803188
267 2908675148
268 2908680546
269 2909075537
270 2919039826
271 2919045933
272 2919071898
273 2919396013
274 2928091768
275 2928503136
276 2935410961
277 2939657199
278 2946034400
279 2966925747
280 2974297563
281 2974326201
282 2977231796
283 2977237154
284 2977254370
285 2977267105
286 2984545057
287 2984553287
288 2984581472
289 2995727077
290 8002813631
291 8055036774
292 8055040792
293 8056039794
294 8057348301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

144

337

0.98

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

85

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7324 121 277
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7116 90 289
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6776 88 291
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.6642 90 278
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.6626 90 289
ID Description Score Start End Superfamily
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8222 86 289 1.10.3720.10
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8189 87 286 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8175 89 289 1.10.3720.10
af_Q2FZQ9_85_310_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8138 85 283 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8073 87 287 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A558DJU8-F1-model_v4 ABC transporter permease 0.8899 1 294 GO:0005886
GO:0055085
AF-A0A0K8Q3B6-F1-model_v4 Dipeptide transport system permease protein DppB 0.8869 127 296 GO:0005886
GO:0055085
AF-A0A558DJU8-F1-model_v4 ABC transporter permease 0.8815 1 294 GO:0005886
GO:0055085
AF-A0A0Q6FY50-F1-model_v4 ABC transporter permease 0.8791 1 294 GO:0005886
GO:0055085
AF-A0A7J9YZF0-F1-model_v4 ABC transporter permease subunit 0.8785 1 294 GO:0005886
GO:0055085

Map