F200029

General Info

Members Datasets Scaffolds Average Seq Length
147 84 294 194

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10050327|Ga0075370_100503272
Length 204
Sequence MEPSTMTAPRKTTSTSPAKGQRIGYVRVSSVDQNDARQLDGVELDKTFTDKASGKDTERPQLKALREFIREGDHLYVHSMDRLSRSLKDLQAVVEELTGRGVSVSFVKEGMTFTGNDDPMATLMLQLLGAVGQFERALIKERQREGIAIAKAKGDVYKGRKPSLDAEAAASLRDMAARGIPKTDIAAKLGISRASVYEYLKAPA

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
48 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
61 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
62 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
63 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
64 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
65 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
70 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
71 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
72 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
73 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
74 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
75 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
76 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
77 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
78 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
79 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
80 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
81 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
82 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
83 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
84 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 2.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0
Rhizoplane 0
Rhizosphere 83.67
Stem 0
Stem Tuber 0
Unclassified 20.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10050327 3300006353 Bacteria 2363
2 SwRhRL2b_contig_374988 2162886007 Bacteria 1523
3 Ga0065714_10197232 3300005288 Bacteria 907
4 Ga0065704_10004812 3300005289 Bacteria 3546
5 Ga0065707_10090419 3300005295 Bacteria 4145
6 Ga0070711_100797924 3300005439 Bacteria 800
7 Ga0070708_100030871 3300005445 Bacteria 4635
8 Ga0070698_100174125 3300005471 Bacteria 2092
9 Ga0070698_100526524 3300005471 Unclassified 1120
10 Ga0070679_100370030 3300005530 Unclassified 1380
11 Ga0068857_100980840 3300005577 Unclassified 813
12 Ga0068856_100912433 3300005614 Unclassified 897
13 Ga0068858_101215672 3300005842 Unclassified 741
14 Ga0070717_10132863 3300006028 Bacteria 2142
15 Ga0075368_10155110 3300006042 Unclassified 957
16 Ga0075432_10005455 3300006058 Bacteria 4334
17 Ga0075367_10132738 3300006178 Unclassified 1540
18 Ga0075366_10000575 3300006195 Bacteria 17232
19 Ga0075428_100038730 3300006844 Bacteria 5246
20 Ga0075428_100091886 3300006844 Bacteria 3309
21 Ga0075428_100112211 3300006844 Bacteria 2969
22 Ga0075428_100292353 3300006844 Unclassified 1752
23 Ga0075428_100450629 3300006844 Unclassified 1378
24 Ga0075428_100622320 3300006844 Bacteria 1152
25 Ga0075430_100055317 3300006846 Bacteria 3337
26 Ga0075430_100271544 3300006846 Unclassified 1403
27 Ga0075430_100885512 3300006846 Unclassified 735
28 Ga0075431_100021463 3300006847 Bacteria 6604
29 Ga0075431_100029740 3300006847 Bacteria 5625
30 Ga0075431_100046023 3300006847 Bacteria 4498
31 Ga0075431_100046551 3300006847 Bacteria 4473
32 Ga0075431_100071399 3300006847 Bacteria 3582
33 Ga0075431_100178012 3300006847 Bacteria 2183
34 Ga0075431_100292122 3300006847 Bacteria 1648
35 Ga0075431_100304608 3300006847 Unclassified 1609
36 Ga0075431_100531382 3300006847 Unclassified 1165
37 Ga0075433_10159043 3300006852 Bacteria 2010
38 Ga0075433_10327201 3300006852 Bacteria 1356
39 Ga0075429_100013121 3300006880 Bacteria 7187
40 Ga0075429_100025842 3300006880 Bacteria 5098
41 Ga0075429_100056072 3300006880 Bacteria 3429
42 Ga0075429_100128429 3300006880 Unclassified 2217
43 Ga0075429_100148410 3300006880 Bacteria 2053
44 Ga0075429_100163188 3300006880 Bacteria 1951
45 Ga0075435_100630184 3300007076 Unclassified 930
46 Ga0105240_10878880 3300009093 Bacteria 966
47 Ga0105245_11755094 3300009098 Bacteria 673
48 Ga0105247_10559979 3300009101 Bacteria 842
49 Ga0114129_10061199 3300009147 Bacteria 5261
50 Ga0114129_10107642 3300009147 Bacteria 3850
51 Ga0114129_10145069 3300009147 Bacteria 3252
52 Ga0114129_10509486 3300009147 Bacteria 1570
53 Ga0105246_10246521 3300011119 Unclassified 1415
54 Ga0157369_10016340 3300013105 Bacteria 8353
55 Ga0157369_10057746 3300013105 Bacteria 4185
56 Ga0157374_10829338 3300013296 Bacteria 941
57 Ga0157375_10190023 3300013308 Bacteria 2208
58 Ga0157375_10642864 3300013308 Unclassified 1217
59 Ga0157377_10691114 3300014745 Bacteria 739
60 Ga0182006_1140629 3300015261 Bacteria 825
61 Ga0206350_11330479 3300020080 Bacteria 918
62 Ga0213875_10003838 3300021388 Bacteria 8438
63 Ga0213875_10034631 3300021388 Bacteria 2384
64 Ga0224712_10083577 3300022467 Bacteria 1323
65 Ga0207705_10025092 3300025909 Bacteria 4255
66 Ga0207695_10000001 3300025913 Bacteria 2888630
67 Ga0207695_10614994 3300025913 Bacteria 967
68 Ga0207671_10403499 3300025914 Bacteria 1087
69 Ga0207667_10185809 3300025949 Bacteria 2133
70 Ga0207702_11037971 3300026078 Bacteria 813
71 Ga0207674_10982084 3300026116 Unclassified 813
72 Ga0209970_1002695 3300027614 Bacteria 3003
73 Ga0265338_10025329 3300028800 Viruses 6026
74 Ga0307512_10006481 3300030522 Bacteria 11852
75 Ga0307405_10293404 3300031731 Bacteria 1230
76 Ga0307413_10762972 3300031824 Bacteria 810
77 Ga0307412_10016375 3300031911 Bacteria 4415
78 Ga0307416_100303631 3300032002 Bacteria 1588
79 Ga0316593_10128600 3300032168 Bacteria 913
80 Ga0395900_0175588 3300037418 Bacteria 2179
81 Ga0395898_0009048 3300037466 Bacteria 10486
82 Ga0395898_0239298 3300037466 Bacteria 1731
83 Ga0436364_0014422 3300037853 Bacteria 3186
84 Ga0436364_0034520 3300037853 Bacteria 1964
85 Ga0436364_0298620 3300037853 Bacteria 1744
86 Ga0436364_0478325 3300037853 Bacteria 1924
87 Ga0436364_1410185 3300037853 Bacteria 1514
88 Ga0395901_0104344 3300038443 Bacteria 2975
89 Ga0395901_0215366 3300038443 Bacteria 2009
90 Ga0436365_1302946 3300039437 Bacteria 3417
91 Ga0436365_1443859 3300039437 Bacteria 10554
92 Ga0436360_0103982 3300039438 Bacteria 2100
93 Ga0436360_0724539 3300039438 Bacteria 688
94 Ga0436363_0232906 3300039450 Bacteria 700
95 Ga0436362_0857593 3300039453 Bacteria 3443
96 Ga0439449_0057777 3300042007 Bacteria 1432
97 Ga0495686_0013543 3300047472 Bacteria 5656
98 Ga0495614_0228126 3300048089 Bacteria 848
99 Ga0496117_0010065 3300048920 Bacteria 8687
100 Ga0496118_0021039 3300048921 Bacteria 5759
101 Ga0496121_0259987 3300048924 Bacteria 1199
102 Ga0501037_0090458 3300049573 Bacteria 2214
103 Ga0501038_0040451 3300049574 Bacteria 4071
104 Ga0501043_0028732 3300049579 Bacteria 4365
105 Ga0501047_0868895 3300049581 Bacteria 715
106 Ga0501044_0088736 3300049823 Bacteria 3121
107 nmdc:mga0k408_625_c1 3300050493 Bacteria 19481
108 nmdc:mga06z11_33872_c1 3300050494 Bacteria 2502
109 nmdc:mga07m45_16244_c1 3300050496 Bacteria 3984
110 nmdc:mga05p37_1188333_c1 3300050507 Unclassified 789
111 nmdc:mga05p37_119167_c1 3300050507 Bacteria 3243
112 nmdc:mga05p37_28176_c1 3300050507 Bacteria 6848
113 nmdc:mga05p37_96977_c1 3300050507 Bacteria 3633
114 nmdc:mga09592_142427_c1 3300050508 Bacteria 2067
115 nmdc:mga09592_187276_c1 3300050508 Unclassified 1791
116 nmdc:mga09592_22125_c1 3300050508 Bacteria 5246
117 nmdc:mga09592_36745_c1 3300050508 Unclassified 4104
118 nmdc:mga09592_491713_c1 3300050508 Unclassified 1057
119 nmdc:mga09592_50086_c1 3300050508 Bacteria 3523
120 nmdc:mga09592_52883_c1 3300050508 Bacteria 3428
121 nmdc:mga09592_558498_c1 3300050508 Unclassified 983
122 nmdc:mga0qj67_113784_c1 3300050509 Bacteria 2186
123 nmdc:mga0qj67_215263_c1 3300050509 Unclassified 1560
124 nmdc:mga0qj67_46108_c1 3300050509 Bacteria 3441
125 nmdc:mga0qj67_713949_c1 3300050509 Unclassified 797
126 nmdc:mga0qj67_72449_c1 3300050509 Bacteria 2751
127 nmdc:mga06r32_100117_c1 3300050510 Bacteria 2843
128 nmdc:mga06r32_1322468_c1 3300050510 Bacteria 664
129 nmdc:mga06r32_231016_c1 3300050510 Bacteria 1838
130 nmdc:mga06r32_23141_c1 3300050510 Bacteria 5749
131 nmdc:mga06r32_27884_c1 3300050510 Bacteria 5281
132 nmdc:mga06r32_281426_c1 3300050510 Bacteria 1650
133 nmdc:mga06r32_365135_c1 3300050510 Unclassified 1427
134 nmdc:mga06r32_390610_c1 3300050510 Unclassified 1374
135 nmdc:mga06r32_413326_c1 3300050510 Unclassified 1331
136 nmdc:mga06r32_67617_c1 3300050510 Bacteria 3450
137 nmdc:mga06r32_84831_c1 3300050510 Unclassified 3088
138 nmdc:mga06r32_8580_c1 3300050510 Bacteria 9213
139 nmdc:mga08y16_1243836_c1 3300050511 Bacteria 713
140 nmdc:mga0rr50_400643_c1 3300050513 Unclassified 1159
141 nmdc:mga0a205_335416_c1 3300050515 Bacteria 1381
142 nmdc:mga0a205_80713_c1 3300050515 Bacteria 3142
143 Ga0500583_0000733 3300053092 Bacteria 9508
144 Ga0500574_000036 3300053141 Bacteria 16882
145 Ga0500634_0000554 3300053161 Bacteria 12321
146 Ga0466962_0219471 3300061719 Bacteria 931
147 Ga0530510_0247100 3300061734 Bacteria 1329
148 Ga0075370_10050327
149 SwRhRL2b_contig_374988
150 Ga0065714_10197232
151 Ga0065704_10004812
152 Ga0065707_10090419
153 Ga0070711_100797924
154 Ga0070708_100030871
155 Ga0070698_100174125
156 Ga0070698_100526524
157 Ga0070679_100370030
158 Ga0068857_100980840
159 Ga0068856_100912433
160 Ga0068858_101215672
161 Ga0070717_10132863
162 Ga0075368_10155110
163 Ga0075432_10005455
164 Ga0075367_10132738
165 Ga0075366_10000575
166 Ga0075428_100038730
167 Ga0075428_100091886
168 Ga0075428_100112211
169 Ga0075428_100292353
170 Ga0075428_100450629
171 Ga0075428_100622320
172 Ga0075430_100055317
173 Ga0075430_100271544
174 Ga0075430_100885512
175 Ga0075431_100021463
176 Ga0075431_100029740
177 Ga0075431_100046023
178 Ga0075431_100046551
179 Ga0075431_100071399
180 Ga0075431_100178012
181 Ga0075431_100292122
182 Ga0075431_100304608
183 Ga0075431_100531382
184 Ga0075433_10159043
185 Ga0075433_10327201
186 Ga0075429_100013121
187 Ga0075429_100025842
188 Ga0075429_100056072
189 Ga0075429_100128429
190 Ga0075429_100148410
191 Ga0075429_100163188
192 Ga0075435_100630184
193 Ga0105240_10878880
194 Ga0105245_11755094
195 Ga0105247_10559979
196 Ga0114129_10061199
197 Ga0114129_10107642
198 Ga0114129_10145069
199 Ga0114129_10509486
200 Ga0105246_10246521
201 Ga0157369_10016340
202 Ga0157369_10057746
203 Ga0157374_10829338
204 Ga0157375_10190023
205 Ga0157375_10642864
206 Ga0157377_10691114
207 Ga0182006_1140629
208 Ga0206350_11330479
209 Ga0213875_10003838
210 Ga0213875_10034631
211 Ga0224712_10083577
212 Ga0207705_10025092
213 Ga0207695_10000001
214 Ga0207695_10614994
215 Ga0207671_10403499
216 Ga0207667_10185809
217 Ga0207702_11037971
218 Ga0207674_10982084
219 Ga0209970_1002695
220 Ga0265338_10025329
221 Ga0307512_10006481
222 Ga0307405_10293404
223 Ga0307413_10762972
224 Ga0307412_10016375
225 Ga0307416_100303631
226 Ga0316593_10128600
227 Ga0395900_0175588
228 Ga0395898_0009048
229 Ga0395898_0239298
230 Ga0436364_0014422
231 Ga0436364_0034520
232 Ga0436364_0298620
233 Ga0436364_0478325
234 Ga0436364_1410185
235 Ga0395901_0104344
236 Ga0395901_0215366
237 Ga0436365_1302946
238 Ga0436365_1443859
239 Ga0436360_0103982
240 Ga0436360_0724539
241 Ga0436363_0232906
242 Ga0436362_0857593
243 Ga0439449_0057777
244 Ga0495686_0013543
245 Ga0495614_0228126
246 Ga0496117_0010065
247 Ga0496118_0021039
248 Ga0496121_0259987
249 Ga0501037_0090458
250 Ga0501038_0040451
251 Ga0501043_0028732
252 Ga0501047_0868895
253 Ga0501044_0088736
254 nmdc:mga0k408_625_c1
255 nmdc:mga06z11_33872_c1
256 nmdc:mga07m45_16244_c1
257 nmdc:mga05p37_1188333_c1
258 nmdc:mga05p37_119167_c1
259 nmdc:mga05p37_28176_c1
260 nmdc:mga05p37_96977_c1
261 nmdc:mga09592_142427_c1
262 nmdc:mga09592_187276_c1
263 nmdc:mga09592_22125_c1
264 nmdc:mga09592_36745_c1
265 nmdc:mga09592_491713_c1
266 nmdc:mga09592_50086_c1
267 nmdc:mga09592_52883_c1
268 nmdc:mga09592_558498_c1
269 nmdc:mga0qj67_113784_c1
270 nmdc:mga0qj67_215263_c1
271 nmdc:mga0qj67_46108_c1
272 nmdc:mga0qj67_713949_c1
273 nmdc:mga0qj67_72449_c1
274 nmdc:mga06r32_100117_c1
275 nmdc:mga06r32_1322468_c1
276 nmdc:mga06r32_231016_c1
277 nmdc:mga06r32_23141_c1
278 nmdc:mga06r32_27884_c1
279 nmdc:mga06r32_281426_c1
280 nmdc:mga06r32_365135_c1
281 nmdc:mga06r32_390610_c1
282 nmdc:mga06r32_413326_c1
283 nmdc:mga06r32_67617_c1
284 nmdc:mga06r32_84831_c1
285 nmdc:mga06r32_8580_c1
286 nmdc:mga08y16_1243836_c1
287 nmdc:mga0rr50_400643_c1
288 nmdc:mga0a205_335416_c1
289 nmdc:mga0a205_80713_c1
290 Ga0500583_0000733
291 Ga0500574_000036
292 Ga0500634_0000554
293 Ga0466962_0219471
294 Ga0530510_0247100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02796

HTH_7

Helix-turn-helix domain of resolvase

159

202

0.97

PF00239

Resolvase

Resolvase, N terminal domain

22

156

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ntz-assembly1.cif.gz_B structure of a parb-dna complex reveals a double b-box interaction 0.8921 152 186
5af3-assembly1.cif.gz_B x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8745 150 182
5af3-assembly1.cif.gz_A x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8731 150 182
8b4h-assembly1.cif.gz_D ista transposase cleaved donor complex 0.8606 145 181
3w2a-assembly1.cif.gz_A crystal structure of virb core domain complexed with the cis-acting site upstream icsp promoter 0.8594 151 184
ID Description Score Start End Superfamily
1fseD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8906 158 184 1.10.10.10
1jkpC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8771 141 181 1.10.10.60
2g0eE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8581 160 181 1.10.10.60
2gbyE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8515 160 181 1.10.10.60
1jkqC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.848 142 185 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A8A5TKS4-F1-model_v4 Recombinase family protein 0.9602 1 97 GO:0000150
GO:0003677
GO:0015074
AF-A0A705X987-F1-model_v4 Recombinase family protein 0.9572 1 91 GO:0000150
GO:0003677
GO:0015074
AF-A0A740Q9B8-F1-model_v4 Recombinase family protein 0.9513 1 133 GO:0000150
GO:0003677
GO:0015074
AF-A0A3D0XBB2-F1-model_v4 Resolvase 0.9478 4 95 GO:0000150
GO:0003677
GO:0015074
AF-A0A705X987-F1-model_v4 Recombinase family protein 0.947 1 91 GO:0000150
GO:0003677
GO:0015074

Map