F199938

General Info

Members Datasets Scaffolds Average Seq Length
147 99 294 246

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10024049|Ga0081538_100240494
Length 280
Sequence MKWYNLRLWVLGCKNARHNTGVDVEKEGGSGMSGHSKWATIRHKKAATDARRGKLFTKLIRELTSAARMGGGAMETNPRLRTAVAAAKNANMPADTIQRAIKKGTGELPGETYEEITYEGYGAGGVAVLVDVLTDNKNRTVAEVRHLFSKHGGNLGESGCVAWMFDRKGYITLGASQIPEDDLLEVVLEAGGDDVRGDGEVYEIYTAPETFEEVRGALEQRGLTIGVAEITMLPQSNVRLEGKQAEQVLRFMDALDDHDDVRKAYANFDISEEVMAQLSS

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
55 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
62 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
71 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
72 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
97 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
98 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
99 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.2
Metatranscriptomes 5.44
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.68
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 6.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10024049 3300005981 Bacteria 4353
2 JGI25406J46586_10020287 3300003203 Bacteria 2691
3 JGI25405J52794_10000153 3300003911 Bacteria 8454
4 Ga0058859_10479692 3300004798 Bacteria 1173
5 Ga0058859_11637433 3300004798 Bacteria 5674
6 Ga0058860_11685305 3300004801 Bacteria 1713
7 Ga0058860_12231088 3300004801 Bacteria 4037
8 Ga0070658_10547962 3300005327 Bacteria 1001
9 Ga0070666_10167172 3300005335 Bacteria 1539
10 Ga0070682_100083728 3300005337 Bacteria 2071
11 Ga0070689_100076800 3300005340 Bacteria 2617
12 Ga0070691_10125506 3300005341 Bacteria 1296
13 Ga0070688_100082204 3300005365 Bacteria 2087
14 Ga0070667_100424175 3300005367 Bacteria 1213
15 Ga0070710_10040216 3300005437 Bacteria 2577
16 Ga0070708_100396952 3300005445 Bacteria 1300
17 Ga0070685_10014542 3300005466 Bacteria 4172
18 Ga0070706_100067963 3300005467 Bacteria 3295
19 Ga0070707_100073747 3300005468 Bacteria 3290
20 Ga0070707_100682598 3300005468 Bacteria 990
21 Ga0070699_100170943 3300005518 Bacteria 1926
22 Ga0070679_100001916 3300005530 Bacteria 18666
23 Ga0070665_100001152 3300005548 Bacteria 32519
24 Ga0068859_100243929 3300005617 Bacteria 1886
25 Ga0068861_100250860 3300005719 Bacteria 1510
26 Ga0068862_100003129 3300005844 Bacteria 14393
27 Ga0081455_10001868 3300005937 Bacteria 25350
28 Ga0081538_10000419 3300005981 Bacteria 47754
29 Ga0081538_10023994 3300005981 Bacteria 4361
30 Ga0081540_1034076 3300005983 Bacteria 2753
31 Ga0081539_10000078 3300005985 Bacteria 226113
32 Ga0081539_10002989 3300005985 Bacteria 22133
33 Ga0081539_10003943 3300005985 Bacteria 17193
34 Ga0081539_10028453 3300005985 Bacteria 3514
35 Ga0075427_10005728 3300006194 Bacteria 1779
36 Ga0075428_100042307 3300006844 Bacteria 5009
37 Ga0075428_100054337 3300006844 Bacteria 4389
38 Ga0075428_100548012 3300006844 Bacteria 1236
39 Ga0075430_100315031 3300006846 Bacteria 1294
40 Ga0075430_100609854 3300006846 Bacteria 900
41 Ga0075431_100081799 3300006847 Bacteria 3334
42 Ga0075431_100168014 3300006847 Bacteria 2255
43 Ga0075429_100300485 3300006880 Bacteria 1405
44 Ga0075429_100323756 3300006880 Bacteria 1349
45 Ga0097620_100243936 3300006931 Bacteria 1886
46 Ga0111539_10117694 3300009094 Unclassified 3114
47 Ga0111539_10379459 3300009094 Bacteria 1646
48 Ga0114129_10298595 3300009147 Bacteria 2148
49 Ga0114129_10872126 3300009147 Bacteria 1142
50 Ga0105249_10089234 3300009553 Bacteria 2881
51 Ga0163162_10548442 3300013306 Bacteria 1284
52 Ga0157375_10610341 3300013308 Bacteria 1249
53 Ga0163163_10132668 3300014325 Bacteria 2531
54 Ga0163163_10636100 3300014325 Bacteria 1130
55 Ga0157379_10003582 3300014968 Bacteria 13159
56 Ga0207692_10031139 3300025898 Bacteria 2552
57 Ga0207680_10003671 3300025903 Bacteria 7210
58 Ga0207684_10049052 3300025910 Bacteria 3582
59 Ga0207652_10012290 3300025921 Bacteria 6915
60 Ga0207646_10133389 3300025922 Bacteria 2236
61 Ga0207668_10114019 3300025972 Bacteria 2034
62 Ga0207658_10141549 3300025986 Bacteria 1947
63 Ga0207675_100237052 3300026118 Bacteria 1762
64 Ga0268266_10001717 3300028379 Bacteria 25077
65 Ga0268265_10002335 3300028380 Bacteria 14402
66 Ga0268264_10340240 3300028381 Bacteria 1425
67 Ga0265338_10602609 3300028800 Bacteria 765
68 Ga0265770_1019995 3300030878 Bacteria 1054
69 Ga0265760_10008719 3300031090 Bacteria 2898
70 Ga0307508_10007658 3300031616 Bacteria 10042
71 Ga0316575_10063734 3300031665 Bacteria 1475
72 Ga0316576_10000380 3300031727 Bacteria 20284
73 Ga0316576_10026343 3300031727 Bacteria 4080
74 Ga0316576_10077361 3300031727 Bacteria 2464
75 Ga0316576_10481602 3300031727 Bacteria 914
76 Ga0316578_10025190 3300031728 Bacteria 3343
77 Ga0316578_10037689 3300031728 Bacteria 2785
78 Ga0316578_10117608 3300031728 Bacteria 1597
79 Ga0316577_10010725 3300031733 Bacteria 4953
80 Ga0316577_10014617 3300031733 Bacteria 4310
81 Ga0316577_10094718 3300031733 Bacteria 1672
82 Ga0307416_100222601 3300032002 Bacteria 1811
83 Ga0307416_101098378 3300032002 Bacteria 900
84 Ga0316593_10127169 3300032168 Bacteria 918
85 Ga0316593_10136912 3300032168 Unclassified 886
86 Ga0373929_0000009 3300035085 Bacteria 202242
87 Ga0373961_0001069 3300035241 Bacteria 8783
88 Ga0316574_0006425 3300035398 Bacteria 6355
89 Ga0316574_0033751 3300035398 Bacteria 3116
90 Ga0316574_0264181 3300035398 Bacteria 1098
91 Ga0373935_0006035 3300035692 Bacteria 7196
92 Ga0373927_0014067 3300035695 Bacteria 5305
93 Ga0373947_0295120 3300035725 Bacteria 1080
94 Ga0316582_0002722 3300036647 Bacteria 8395
95 Ga0316582_0010364 3300036647 Bacteria 5101
96 Ga0316582_0044704 3300036647 Bacteria 2786
97 Ga0316582_0054525 3300036647 Bacteria 2545
98 Ga0316582_0122452 3300036647 Bacteria 1741
99 Ga0316582_0370435 3300036647 Bacteria 986
100 Ga0316582_0378243 3300036647 Bacteria 975
101 Ga0316582_0629916 3300036647 Bacteria 738
102 Ga0316584_0047621 3300036712 Bacteria 3203
103 Ga0316584_0171698 3300036712 Unclassified 1608
104 Ga0316584_0241059 3300036712 Bacteria 1323
105 Ga0316584_0241973 3300036712 Bacteria 1320
106 Ga0395901_0446147 3300038443 Bacteria 1324
107 Ga0451837_1385326 3300041494 Bacteria 3283
108 Ga0439463_004417 3300042016 Bacteria 3526
109 Ga0439444_0001535 3300042437 Bacteria 3030
110 Ga0451577_0113404 3300042876 Bacteria 2426
111 Ga0451577_0446854 3300042876 Bacteria 1174
112 Ga0453684_0000207 3300044712 Bacteria 256144
113 Ga0453684_0028173 3300044712 Bacteria 8026
114 Ga0453684_0145104 3300044712 Bacteria 2828
115 Ga0453684_0337304 3300044712 Bacteria 1703
116 Ga0451576_0405217 3300045051 Bacteria 1430
117 Ga0495608_0280745 3300046511 Bacteria 1034
118 Ga0495630_0250283 3300046517 Bacteria 1354
119 Ga0495604_0200215 3300047317 Bacteria 1386
120 Ga0495602_0047269 3300048088 Bacteria 3879
121 Ga0496114_0000055 3300048917 Bacteria 96533
122 Ga0501036_0658523 3300049572 Bacteria 867
123 Ga0501041_0144142 3300049577 Unclassified 1486
124 Ga0501041_0213057 3300049577 Bacteria 1212
125 Ga0501042_0186612 3300049578 Unclassified 1496
126 Ga0501068_0008932 3300049584 Bacteria 5593
127 Ga0501068_0230176 3300049584 Unclassified 1179
128 Ga0501075_0001039 3300049591 Bacteria 17831
129 Ga0501075_0171828 3300049591 Unclassified 1654
130 Ga0501076_0018616 3300049592 Bacteria 5298
131 Ga0501077_0000095 3300049593 Bacteria 45921
132 Ga0501077_0159707 3300049593 Unclassified 1431
133 Ga0501080_0012790 3300049742 Bacteria 7698
134 Ga0501081_0130167 3300049743 Bacteria 1798
135 Ga0501045_0163674 3300049824 Unclassified 1656
136 nmdc:mga05p37_27450_c1 3300050507 Bacteria 6931
137 nmdc:mga05p37_815238_c1 3300050507 Bacteria 1019
138 nmdc:mga09592_346125_c1 3300050508 Bacteria 1287
139 nmdc:mga06r32_172157_c1 3300050510 Bacteria 2149
140 nmdc:mga06r32_197130_c1 3300050510 Bacteria 1546
141 nmdc:mga08y16_16299_c1 3300050511 Bacteria 7814
142 nmdc:mga0n895_42209_c1 3300050512 Bacteria 4437
143 Ga0501082_0004726 3300060353 Bacteria 11876
144 Ga0501082_0049392 3300060353 Bacteria 3628
145 Ga0530510_0141368 3300061734 Bacteria 1774
146 2556062822 2554235469 Bacteria 3590176
147 2712198085 2711768088 Bacteria 3195027
148 Ga0081538_10024049
149 JGI25406J46586_10020287
150 JGI25405J52794_10000153
151 Ga0058859_10479692
152 Ga0058859_11637433
153 Ga0058860_11685305
154 Ga0058860_12231088
155 Ga0070658_10547962
156 Ga0070666_10167172
157 Ga0070682_100083728
158 Ga0070689_100076800
159 Ga0070691_10125506
160 Ga0070688_100082204
161 Ga0070667_100424175
162 Ga0070710_10040216
163 Ga0070708_100396952
164 Ga0070685_10014542
165 Ga0070706_100067963
166 Ga0070707_100073747
167 Ga0070707_100682598
168 Ga0070699_100170943
169 Ga0070679_100001916
170 Ga0070665_100001152
171 Ga0068859_100243929
172 Ga0068861_100250860
173 Ga0068862_100003129
174 Ga0081455_10001868
175 Ga0081538_10000419
176 Ga0081538_10023994
177 Ga0081540_1034076
178 Ga0081539_10000078
179 Ga0081539_10002989
180 Ga0081539_10003943
181 Ga0081539_10028453
182 Ga0075427_10005728
183 Ga0075428_100042307
184 Ga0075428_100054337
185 Ga0075428_100548012
186 Ga0075430_100315031
187 Ga0075430_100609854
188 Ga0075431_100081799
189 Ga0075431_100168014
190 Ga0075429_100300485
191 Ga0075429_100323756
192 Ga0097620_100243936
193 Ga0111539_10117694
194 Ga0111539_10379459
195 Ga0114129_10298595
196 Ga0114129_10872126
197 Ga0105249_10089234
198 Ga0163162_10548442
199 Ga0157375_10610341
200 Ga0163163_10132668
201 Ga0163163_10636100
202 Ga0157379_10003582
203 Ga0207692_10031139
204 Ga0207680_10003671
205 Ga0207684_10049052
206 Ga0207652_10012290
207 Ga0207646_10133389
208 Ga0207668_10114019
209 Ga0207658_10141549
210 Ga0207675_100237052
211 Ga0268266_10001717
212 Ga0268265_10002335
213 Ga0268264_10340240
214 Ga0265338_10602609
215 Ga0265770_1019995
216 Ga0265760_10008719
217 Ga0307508_10007658
218 Ga0316575_10063734
219 Ga0316576_10000380
220 Ga0316576_10026343
221 Ga0316576_10077361
222 Ga0316576_10481602
223 Ga0316578_10025190
224 Ga0316578_10037689
225 Ga0316578_10117608
226 Ga0316577_10010725
227 Ga0316577_10014617
228 Ga0316577_10094718
229 Ga0307416_100222601
230 Ga0307416_101098378
231 Ga0316593_10127169
232 Ga0316593_10136912
233 Ga0373929_0000009
234 Ga0373961_0001069
235 Ga0316574_0006425
236 Ga0316574_0033751
237 Ga0316574_0264181
238 Ga0373935_0006035
239 Ga0373927_0014067
240 Ga0373947_0295120
241 Ga0316582_0002722
242 Ga0316582_0010364
243 Ga0316582_0044704
244 Ga0316582_0054525
245 Ga0316582_0122452
246 Ga0316582_0370435
247 Ga0316582_0378243
248 Ga0316582_0629916
249 Ga0316584_0047621
250 Ga0316584_0171698
251 Ga0316584_0241059
252 Ga0316584_0241973
253 Ga0395901_0446147
254 Ga0451837_1385326
255 Ga0439463_004417
256 Ga0439444_0001535
257 Ga0451577_0113404
258 Ga0451577_0446854
259 Ga0453684_0000207
260 Ga0453684_0028173
261 Ga0453684_0145104
262 Ga0453684_0337304
263 Ga0451576_0405217
264 Ga0495608_0280745
265 Ga0495630_0250283
266 Ga0495604_0200215
267 Ga0495602_0047269
268 Ga0496114_0000055
269 Ga0501036_0658523
270 Ga0501041_0144142
271 Ga0501041_0213057
272 Ga0501042_0186612
273 Ga0501068_0008932
274 Ga0501068_0230176
275 Ga0501075_0001039
276 Ga0501075_0171828
277 Ga0501076_0018616
278 Ga0501077_0000095
279 Ga0501077_0159707
280 Ga0501080_0012790
281 Ga0501081_0130167
282 Ga0501045_0163674
283 nmdc:mga05p37_27450_c1
284 nmdc:mga05p37_815238_c1
285 nmdc:mga09592_346125_c1
286 nmdc:mga06r32_172157_c1
287 nmdc:mga06r32_197130_c1
288 nmdc:mga08y16_16299_c1
289 nmdc:mga0n895_42209_c1
290 Ga0501082_0004726
291 Ga0501082_0049392
292 Ga0530510_0141368
293 2556062822
294 2712198085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01709

Transcrip_reg

TACO1/YebC second and third domain

113

268

0.98

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

36

107

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8811 18 241
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8751 24 238
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8559 3 245
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8532 24 238
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8455 3 245
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9912 27 74 1.10.10.200
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9765 19 75 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9365 83 241 3.30.70.980
4f3qA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9087 131 206 3.30.70.980
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9072 5 79 1.10.10.200
ID Description Score Start End GO Terms
AF-K1UEW2-F1-model_v4 Protein containing DUF28 0.9756 84 238 GO:0005829
AF-A0A7W1IE32-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9732 52 249 GO:0003677
GO:0005829
GO:0006355
AF-A0A2M6R9V3-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.971 86 240 GO:0003677
GO:0005829
AF-A0A432IAP2-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.968 1 186 GO:0003677
GO:0005829
AF-A0A2A6E053-F1-model_v4 Probable transcriptional regulatory protein BLM47_06820 0.965 21 241 GO:0003677
GO:0005829
GO:0006355

Map