F198239

General Info

Members Datasets Scaffolds Average Seq Length
146 112 146 109

Family's Representative Sequence

Representative Sequence 3300041453|Ga0451797_1167849|Ga0451797_1167849_158_538
Length 126
Sequence MAKKKNVPSTDAPVETAAEAAAREQRTTERVTINKEFESFDAFIQEYVTNISRTGVFVKSKQPLPIGTKVNLKFTVIMDDIETIEGIGEVVRVEKSPSGMGVVFRELSHYSQGLIDKLLTQRKDGP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
52 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
53 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
56 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
74 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
75 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
87 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
88 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
89 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
90 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 1.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.37
Rhizosphere 89.73
Stem 0
Stem Tuber 0
Unclassified 8.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100279823 3300005329 Bacteria 1587
2 Ga0070682_101309931 3300005337 Bacteria 616
3 Ga0068868_100093001 3300005338 Bacteria 2431
4 Ga0070675_100983770 3300005354 Bacteria 774
5 Ga0070694_100123931 3300005444 Bacteria 1858
6 Ga0068867_100087855 3300005459 Bacteria 2355
7 Ga0070685_11306416 3300005466 Bacteria 554
8 Ga0070707_100612924 3300005468 Bacteria 1051
9 Ga0070707_102241355 3300005468 Bacteria 514
10 Ga0070699_101357349 3300005518 Unclassified 652
11 Ga0070679_101587677 3300005530 Bacteria 602
12 Ga0070679_102112049 3300005530 Bacteria 513
13 Ga0070704_100371125 3300005549 Bacteria 1213
14 Ga0068856_100272646 3300005614 Bacteria 1708
15 Ga0068859_101058906 3300005617 Bacteria 892
16 Ga0068859_102860694 3300005617 Bacteria 529
17 Ga0068863_100028611 3300005841 Bacteria 5320
18 Ga0068860_100724389 3300005843 Bacteria 1005
19 Ga0068862_100390581 3300005844 Bacteria 1300
20 Ga0097621_100115823 3300006237 Bacteria 2269
21 Ga0075428_101049238 3300006844 Bacteria 862
22 Ga0075431_100144327 3300006847 Bacteria 2453
23 Ga0075434_102506831 3300006871 Bacteria 517
24 Ga0075429_100335209 3300006880 Bacteria 1324
25 Ga0075429_100379429 3300006880 Bacteria 1238
26 Ga0075429_100642456 3300006880 Bacteria 930
27 Ga0068865_100458742 3300006881 Bacteria 1055
28 Ga0097620_101058769 3300006931 Bacteria 892
29 Ga0097620_102860877 3300006931 Bacteria 529
30 Ga0105240_10853295 3300009093 Bacteria 983
31 Ga0105247_10003166 3300009101 Bacteria 10849
32 Ga0114129_10764607 3300009147 Bacteria 1236
33 Ga0105242_10329797 3300009176 Bacteria 1403
34 Ga0105239_11799480 3300010375 Bacteria 710
35 Ga0105246_11671648 3300011119 Bacteria 604
36 Ga0157374_11857012 3300013296 Bacteria 628
37 Ga0157378_11211169 3300013297 Bacteria 795
38 Ga0157379_10456121 3300014968 Bacteria 1181
39 Ga0157376_10126150 3300014969 Bacteria 2277
40 Ga0182007_10109590 3300015262 Bacteria 918
41 Ga0207642_10878734 3300025899 Bacteria 573
42 Ga0207710_10006668 3300025900 Bacteria 4920
43 Ga0207645_11040914 3300025907 Bacteria 553
44 Ga0207652_11219022 3300025921 Bacteria 654
45 Ga0207686_10248822 3300025934 Bacteria 1297
46 Ga0207661_10251497 3300025944 Bacteria 1571
47 Ga0207639_12178130 3300026041 Bacteria 516
48 Ga0207708_12002974 3300026075 Bacteria 507
49 Ga0207648_10112594 3300026089 Bacteria 2389
50 Ga0268265_10268788 3300028380 Bacteria 1520
51 Ga0268264_10957010 3300028381 Bacteria 861
52 Ga0268264_11010209 3300028381 Bacteria 838
53 Ga0265319_1000441 3300028563 Bacteria 29803
54 Ga0265319_1030925 3300028563 Bacteria 1868
55 Ga0265318_10000036 3300028577 Bacteria 138442
56 Ga0265318_10001207 3300028577 Bacteria 15718
57 Ga0265338_10032891 3300028800 Bacteria 5048
58 Ga0265338_10087815 3300028800 Bacteria 2582
59 Ga0265762_1101382 3300030760 Unclassified 639
60 Ga0265760_10072412 3300031090 Bacteria 1058
61 Ga0265330_10000583 3300031235 Bacteria 23788
62 Ga0265332_10000460 3300031238 Bacteria 28375
63 Ga0265328_10001925 3300031239 Bacteria 9440
64 Ga0265320_10002072 3300031240 Bacteria 14121
65 Ga0265320_10050241 3300031240 Bacteria 2028
66 Ga0265325_10003556 3300031241 Bacteria 10115
67 Ga0265329_10000356 3300031242 Bacteria 24195
68 Ga0265329_10224090 3300031242 Bacteria 623
69 Ga0265340_10001486 3300031247 Bacteria 13441
70 Ga0265340_10010645 3300031247 Bacteria 4917
71 Ga0265339_10006794 3300031249 Bacteria 7463
72 Ga0265331_10001234 3300031250 Bacteria 19204
73 Ga0265316_10001047 3300031344 Bacteria 29971
74 Ga0265316_10041889 3300031344 Bacteria 3661
75 Ga0307513_10133969 3300031456 Bacteria 2417
76 Ga0265313_10000046 3300031595 Bacteria 114012
77 Ga0265313_10000418 3300031595 Bacteria 45584
78 Ga0265314_10001682 3300031711 Bacteria 24083
79 Ga0265342_10001034 3300031712 Bacteria 27269
80 Ga0265342_10027004 3300031712 Bacteria 3594
81 Ga0316576_10000089 3300031727 Bacteria 32274
82 Ga0316576_10023716 3300031727 Bacteria 4278
83 Ga0316576_10066407 3300031727 Bacteria 2653
84 Ga0316578_10101127 3300031728 Bacteria 1728
85 Ga0316577_10047452 3300031733 Bacteria 2398
86 Ga0307414_10696221 3300032004 Bacteria 920
87 Ga0307507_10045793 3300033179 Bacteria 4298
88 Ga0373936_0192212 3300035113 Bacteria 899
89 Ga0373939_0075399 3300035114 Bacteria 1108
90 Ga0373953_0306122 3300035117 Bacteria 694
91 Ga0373953_0484448 3300035117 Bacteria 548
92 Ga0373957_0388185 3300035120 Bacteria 600
93 Ga0373955_0255928 3300035172 Bacteria 1050
94 Ga0316574_0011844 3300035398 Bacteria 4971
95 Ga0316574_0400940 3300035398 Bacteria 864
96 Ga0373931_0560457 3300035691 Bacteria 743
97 Ga0373935_0078027 3300035692 Bacteria 2148
98 Ga0373935_0340350 3300035692 Bacteria 1068
99 Ga0373927_0005480 3300035695 Bacteria 8742
100 Ga0373927_0814087 3300035695 Bacteria 617
101 Ga0373937_0160749 3300036401 Bacteria 2106
102 Ga0373937_0920942 3300036401 Bacteria 823
103 Ga0316584_0000391 3300036712 Bacteria 22735
104 Ga0316584_0468199 3300036712 Unclassified 889
105 Ga0373925_0028556 3300037068 Bacteria 4087
106 Ga0436365_0861499 3300039437 Bacteria 3184
107 Ga0436360_1265818 3300039438 Bacteria 856
108 Ga0436361_0589160 3300039447 Bacteria 577
109 Ga0436361_0910966 3300039447 Bacteria 1009
110 Ga0436361_1109063 3300039447 Bacteria 920
111 Ga0436363_0268919 3300039450 Bacteria 534
112 Ga0451797_1167849 3300041453 Bacteria 601
113 Ga0451804_0502492 3300041463 Unclassified 714
114 Ga0451835_0537247 3300041492 Bacteria 588
115 Ga0451849_0037965 3300041505 Bacteria 546
116 Ga0451849_0955582 3300041505 Bacteria 1494
117 Ga0451851_1103452 3300041507 Bacteria 1058
118 Ga0451843_0498307 3300041509 Bacteria 901
119 Ga0451853_2328441 3300041512 Bacteria 8190
120 Ga0439445_0064127 3300042004 Bacteria 1008
121 Ga0466960_0153675 3300044901 Bacteria 1231
122 Ga0466967_1798362 3300045976 Bacteria 610
123 Ga0495582_0724097 3300046473 Bacteria 576
124 Ga0495628_0395542 3300046516 Bacteria 1010
125 Ga0495635_0309900 3300046663 Bacteria 1058
126 Ga0495669_0131734 3300046684 Bacteria 1177
127 Ga0496119_0181073 3300048922 Bacteria 1105
128 Ga0496123_0353089 3300048926 Bacteria 683
129 Ga0501034_0040080 3300049571 Bacteria 4743
130 Ga0501034_1698910 3300049571 Bacteria 504
131 Ga0501067_0224320 3300049583 Bacteria 1046
132 Ga0501073_0096266 3300049589 Bacteria 2055
133 Ga0501073_1006588 3300049589 Bacteria 573
134 Ga0501076_0531926 3300049592 Unclassified 969
135 Ga0501079_0683138 3300049741 Unclassified 808
136 Ga0501080_0151089 3300049742 Bacteria 2146
137 Ga0501083_0014052 3300049744 Bacteria 5597
138 Ga0501083_0025466 3300049744 Bacteria 4096
139 Ga0501083_0503579 3300049744 Bacteria 788
140 nmdc:mga0k408_20349_c1 3300050493 Bacteria 3716
141 nmdc:mga09592_325046_c1 3300050508 Bacteria 1332
142 nmdc:mga09592_371307_c1 3300050508 Bacteria 1237
143 nmdc:mga09592_753360_c1 3300050508 Bacteria 826
144 nmdc:mga06r32_571437_c1 3300050510 Bacteria 1103
145 Ga0501084_0001672 3300054114 Bacteria 17630
146 Ga0501084_0062388 3300054114 Bacteria 3120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031728 Ga0316578_10101127 Ga0316578_101011272 98
2 3300031733 Ga0316577_10047452 Ga0316577_100474522 98
3 3300036712 Ga0316584_0000391 Ga0316584_0000391_1324_1632 98
4 3300031727 Ga0316576_10000089 Ga0316576_1000008913 99
5 3300049589 Ga0501073_0096266 Ga0501073_0096266_349_654 101
6 3300049592 Ga0501076_0531926 Ga0501076_0531926_311_616 101
7 3300049741 Ga0501079_0683138 Ga0501079_0683138_157_462 101
8 3300049742 Ga0501080_0151089 Ga0501080_0151089_983_1288 101
9 3300049744 Ga0501083_0014052 Ga0501083_0014052_3201_3506 101
10 3300049744 Ga0501083_0025466 Ga0501083_0025466_2124_2429 101
11 3300054114 Ga0501084_0001672 Ga0501084_0001672_4022_4327 101
12 3300054114 Ga0501084_0062388 Ga0501084_0062388_1695_2000 101
13 3300005337 Ga0070682_101309931 Ga0070682_1013099311 102
14 3300005338 Ga0068868_100093001 Ga0068868_1000930013 102
15 3300005459 Ga0068867_100087855 Ga0068867_1000878553 102
16 3300005614 Ga0068856_100272646 Ga0068856_1002726462 102
17 3300005841 Ga0068863_100028611 Ga0068863_1000286112 102
18 3300005843 Ga0068860_100724389 Ga0068860_1007243891 102
19 3300006237 Ga0097621_100115823 Ga0097621_1001158233 102
20 3300006880 Ga0075429_100335209 Ga0075429_1003352092 102
21 3300006881 Ga0068865_100458742 Ga0068865_1004587422 102
22 3300009176 Ga0105242_10329797 Ga0105242_103297972 102
23 3300013296 Ga0157374_11857012 Ga0157374_118570122 102
24 3300014969 Ga0157376_10126150 Ga0157376_101261503 102
25 3300025899 Ga0207642_10878734 Ga0207642_108787342 102
26 3300025907 Ga0207645_11040914 Ga0207645_110409141 102
27 3300025934 Ga0207686_10248822 Ga0207686_102488223 102
28 3300026089 Ga0207648_10112594 Ga0207648_101125942 102
29 3300031090 Ga0265760_10072412 Ga0265760_100724122 102
30 3300048926 Ga0496123_0353089 Ga0496123_0353089_250_558 102
31 3300049744 Ga0501083_0503579 Ga0501083_0503579_356_664 102
32 3300050508 nmdc:mga09592_325046_c1 nmdc:mga09592_325046_c1_590_913 102
33 3300005468 Ga0070707_100612924 Ga0070707_1006129241 103
34 3300005549 Ga0070704_100371125 Ga0070704_1003711252 103
35 3300005617 Ga0068859_102860694 Ga0068859_1028606942 103
36 3300006931 Ga0097620_102860877 Ga0097620_1028608772 103
37 3300013297 Ga0157378_11211169 Ga0157378_112111691 103
38 3300028381 Ga0268264_10957010 Ga0268264_109570101 103
39 3300028563 Ga0265319_1030925 Ga0265319_10309252 103
40 3300044901 Ga0466960_0153675 Ga0466960_0153675_374_697 103
41 3300045976 Ga0466967_1798362 Ga0466967_1798362_242_553 103
42 3300006880 Ga0075429_100379429 Ga0075429_1003794293 104
43 3300009093 Ga0105240_10853295 Ga0105240_108532952 104
44 3300009101 Ga0105247_10003166 Ga0105247_100031663 104
45 3300014968 Ga0157379_10456121 Ga0157379_104561212 104
46 3300025900 Ga0207710_10006668 Ga0207710_100066683 104
47 3300035692 Ga0373935_0340350 Ga0373935_0340350_290_610 104
48 3300036712 Ga0316584_0468199 Ga0316584_0468199_317_670 104
49 3300041463 Ga0451804_0502492 Ga0451804_0502492_289_603 104
50 3300041492 Ga0451835_0537247 Ga0451835_0537247_111_428 104
51 3300041505 Ga0451849_0037965 Ga0451849_0037965_187_528 104
52 3300041505 Ga0451849_0955582 Ga0451849_0955582_138_455 104
53 3300041507 Ga0451851_1103452 Ga0451851_1103452_90_407 104
54 3300041509 Ga0451843_0498307 Ga0451843_0498307_338_655 104
55 3300041512 Ga0451853_2328441 Ga0451853_2328441_1427_1744 104
56 3300049583 Ga0501067_0224320 Ga0501067_0224320_500_814 104
57 3300050493 nmdc:mga0k408_20349_c1 nmdc:mga0k408_20349_c1_1524_1838 104
58 3300050508 nmdc:mga09592_371307_c1 nmdc:mga09592_371307_c1_351_689 104
59 3300005329 Ga0070683_100279823 Ga0070683_1002798232 105
60 3300005354 Ga0070675_100983770 Ga0070675_1009837702 105
61 3300005444 Ga0070694_100123931 Ga0070694_1001239312 105
62 3300005466 Ga0070685_11306416 Ga0070685_113064161 105
63 3300005468 Ga0070707_102241355 Ga0070707_1022413551 105
64 3300005518 Ga0070699_101357349 Ga0070699_1013573491 105
65 3300005530 Ga0070679_101587677 Ga0070679_1015876771 105
66 3300005530 Ga0070679_102112049 Ga0070679_1021120491 105
67 3300005617 Ga0068859_101058906 Ga0068859_1010589062 105
68 3300005844 Ga0068862_100390581 Ga0068862_1003905812 105
69 3300006844 Ga0075428_101049238 Ga0075428_1010492383 105
70 3300006847 Ga0075431_100144327 Ga0075431_1001443273 105
71 3300006871 Ga0075434_102506831 Ga0075434_1025068311 105
72 3300006880 Ga0075429_100642456 Ga0075429_1006424562 105
73 3300006931 Ga0097620_101058769 Ga0097620_1010587692 105
74 3300009147 Ga0114129_10764607 Ga0114129_107646072 105
75 3300010375 Ga0105239_11799480 Ga0105239_117994801 105
76 3300011119 Ga0105246_11671648 Ga0105246_116716482 105
77 3300015262 Ga0182007_10109590 Ga0182007_101095902 105
78 3300025921 Ga0207652_11219022 Ga0207652_112190222 105
79 3300025944 Ga0207661_10251497 Ga0207661_102514973 105
80 3300026041 Ga0207639_12178130 Ga0207639_121781301 105
81 3300026075 Ga0207708_12002974 Ga0207708_120029741 105
82 3300028380 Ga0268265_10268788 Ga0268265_102687883 105
83 3300028381 Ga0268264_11010209 Ga0268264_110102091 105
84 3300028563 Ga0265319_1000441 Ga0265319_10004418 105
85 3300028577 Ga0265318_10000036 Ga0265318_1000003699 105
86 3300028577 Ga0265318_10001207 Ga0265318_1000120712 105
87 3300028800 Ga0265338_10032891 Ga0265338_100328914 105
88 3300028800 Ga0265338_10087815 Ga0265338_100878153 105
89 3300030760 Ga0265762_1101382 Ga0265762_11013821 105
90 3300031235 Ga0265330_10000583 Ga0265330_100005839 105
91 3300031238 Ga0265332_10000460 Ga0265332_1000046013 105
92 3300031239 Ga0265328_10001925 Ga0265328_100019253 105
93 3300031240 Ga0265320_10002072 Ga0265320_100020723 105
94 3300031240 Ga0265320_10050241 Ga0265320_100502412 105
95 3300031241 Ga0265325_10003556 Ga0265325_100035568 105
96 3300031242 Ga0265329_10000356 Ga0265329_1000035613 105
97 3300031242 Ga0265329_10224090 Ga0265329_102240902 105
98 3300031247 Ga0265340_10001486 Ga0265340_100014867 105
99 3300031247 Ga0265340_10010645 Ga0265340_100106452 105
100 3300031249 Ga0265339_10006794 Ga0265339_100067942 105
101 3300031250 Ga0265331_10001234 Ga0265331_100012347 105
102 3300031344 Ga0265316_10001047 Ga0265316_1000104712 105
103 3300031344 Ga0265316_10041889 Ga0265316_100418893 105
104 3300031456 Ga0307513_10133969 Ga0307513_101339692 105
105 3300031595 Ga0265313_10000046 Ga0265313_1000004612 105
106 3300031595 Ga0265313_10000418 Ga0265313_1000041838 105
107 3300031711 Ga0265314_10001682 Ga0265314_1000168213 105
108 3300031712 Ga0265342_10001034 Ga0265342_1000103411 105
109 3300031712 Ga0265342_10027004 Ga0265342_100270043 105
110 3300031727 Ga0316576_10023716 Ga0316576_100237162 105
111 3300031727 Ga0316576_10066407 Ga0316576_100664073 105
112 3300032004 Ga0307414_10696221 Ga0307414_106962212 105
113 3300033179 Ga0307507_10045793 Ga0307507_100457932 105
114 3300035113 Ga0373936_0192212 Ga0373936_0192212_114_461 105
115 3300035114 Ga0373939_0075399 Ga0373939_0075399_568_912 105
116 3300035117 Ga0373953_0306122 Ga0373953_0306122_325_645 105
117 3300035117 Ga0373953_0484448 Ga0373953_0484448_23_367 105
118 3300035120 Ga0373957_0388185 Ga0373957_0388185_117_437 105
119 3300035172 Ga0373955_0255928 Ga0373955_0255928_53_373 105
120 3300035398 Ga0316574_0011844 Ga0316574_0011844_3518_3841 105
121 3300035398 Ga0316574_0400940 Ga0316574_0400940_192_521 105
122 3300035691 Ga0373931_0560457 Ga0373931_0560457_131_478 105
123 3300035692 Ga0373935_0078027 Ga0373935_0078027_676_1050 105
124 3300035695 Ga0373927_0005480 Ga0373927_0005480_5890_6264 105
125 3300035695 Ga0373927_0814087 Ga0373927_0814087_46_387 105
126 3300036401 Ga0373937_0160749 Ga0373937_0160749_1470_1790 105
127 3300036401 Ga0373937_0920942 Ga0373937_0920942_16_336 105
128 3300037068 Ga0373925_0028556 Ga0373925_0028556_666_1040 105
129 3300039437 Ga0436365_0861499 Ga0436365_0861499_1984_2325 105
130 3300039438 Ga0436360_1265818 Ga0436360_1265818_68_391 105
131 3300039447 Ga0436361_0589160 Ga0436361_0589160_186_557 105
132 3300039447 Ga0436361_0910966 Ga0436361_0910966_160_483 105
133 3300039447 Ga0436361_1109063 Ga0436361_1109063_368_730 105
134 3300039450 Ga0436363_0268919 Ga0436363_0268919_142_477 105
135 3300041453 Ga0451797_1167849 Ga0451797_1167849_158_538 105
136 3300042004 Ga0439445_0064127 Ga0439445_0064127_17_370 105
137 3300046473 Ga0495582_0724097 Ga0495582_0724097_192_533 105
138 3300046516 Ga0495628_0395542 Ga0495628_0395542_572_892 105
139 3300046663 Ga0495635_0309900 Ga0495635_0309900_305_652 105
140 3300046684 Ga0495669_0131734 Ga0495669_0131734_490_816 105
141 3300048922 Ga0496119_0181073 Ga0496119_0181073_37_393 105
142 3300049571 Ga0501034_0040080 Ga0501034_0040080_2245_2589 105
143 3300049571 Ga0501034_1698910 Ga0501034_1698910_89_469 105
144 3300049589 Ga0501073_1006588 Ga0501073_1006588_68_415 105
145 3300050508 nmdc:mga09592_753360_c1 nmdc:mga09592_753360_c1_390_719 105
146 3300050510 nmdc:mga06r32_571437_c1 nmdc:mga06r32_571437_c1_380_706 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

21

121

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rt1-assembly1.cif.gz_A structure of the alg44 pilz domain (r95a mutant) from pseudomonas aeruginosa pao1 in complex with c-di-gmp 0.8299 28 101
5vx6-assembly1.cif.gz_A structure of bacillus subtilis inhibitor of motility (moti/dgra) 0.8246 31 105
5vx6-assembly2.cif.gz_B structure of bacillus subtilis inhibitor of motility (moti/dgra) 0.7893 31 105
1ywu-assembly1.cif.gz_A solution nmr structure of pseudomonas aeruginosa protein pa4608. northeast structural genomics target pat7 0.7842 30 101
4rt0-assembly1.cif.gz_A structure of the alg44 pilz domain from pseudomonas aeruginosa pao1 in complex with c-di-gmp 0.7783 28 100
ID Description Score Start End Superfamily
4xrnD00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8494 28 100 2.40.10.220
af_P37653_690_796_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.752 28 97 2.40.10.220
3kygB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7116 27 87 2.30.110.10
af_Q9FKS7_197_293_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.701 49 84 3.30.450.20
af_Q09820_245_336_2.40.30.230 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.7006 35 85 2.40.30.230
ID Description Score Start End GO Terms
AF-A0A7C4KTI0-F1-model_v4 PilZ domain-containing protein 0.9485 28 98 GO:0035438
AF-A0A3M2ACK9-F1-model_v4 PilZ domain-containing protein 0.9138 27 105 GO:0035438
AF-A6GBP0-F1-model_v4 PilZ domain-containing protein 0.9106 27 104 GO:0035438
AF-A0A850G6J5-F1-model_v4 PilZ domain-containing protein 0.9098 27 105 GO:0035438
AF-A0A2M7KIN0-F1-model_v4 PilZ domain-containing protein 0.9085 31 101 GO:0035438

Feature Viewer

pLDDT pTM Quality
76.96 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map