F197937

General Info

Members Datasets Scaffolds Average Seq Length
146 70 146 508

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10030555|Ga0265338_100305552
Length 561
Sequence VDFNSYIVSTVIFAPLLGALILAFIPSTEKGQLKVATLFTMLVTFGLSLWMYFDFQTGPKALEFQLMQKNVWVEHFGLAYSVGIDGVSATLMLLTGFLGPIVMLAAWNNAGERAKEFCVALLVLQTSMMGTFAAMDVVLFYVFWEGVLIPMYLLIGIFGSENRIYASVKFFLFTMVGSMLMLVAIIYVYLKTGDASGMGRSFEYDKMLFAAQHLTETEQLYLFIAFASAFAVKVPMWPLHTWLPDAHTEAPAAGSIVLAGVMLKMGTFGFMRYAMPMFPEATKQAAPWIGILAVIGIVYGSLMCLAQRDMKRLVAYSSVAHLGFVMLGLAALNTQASAGAVYQMVNHGVSTGALFLLIGAIYERRHTRLIAEYGGLAKVTPLLGIAFLVITFSSIGLPGTNGFIGEFMILSGTFTQGRIFGHTIFTGLQLSWVWLAAIAATGVILGAAYMLTLVQRVWFGPLRNPRNQGLADMSWREGFAVVPLVLAALGMGIFPQPFLDRINPAAEIFSRRSAGEALALNATAESPAEPEAGPVHPLPALHLGQPGPGARPVVVPNPAQR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
13 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
16 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
17 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
27 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
28 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
34 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
35 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
36 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
39 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
40 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
41 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
44 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
45 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
50 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
53 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
54 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
55 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
63 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
64 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
65 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
66 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
67 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
68 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
69 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
70 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 2.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.63
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10008345 3300005289 Bacteria 2887
2 Ga0065704_10073492 3300005289 Bacteria 7105
3 Ga0065704_10115200 3300005289 Bacteria 1876
4 Ga0065707_10090618 3300005295 Bacteria 4104
5 Ga0070694_100025184 3300005444 Bacteria 3848
6 Ga0070708_100050241 3300005445 Bacteria 3691
7 Ga0070708_100195758 3300005445 Bacteria 1891
8 Ga0070708_100206311 3300005445 Bacteria 1841
9 Ga0070706_100092409 3300005467 Bacteria 2807
10 Ga0070698_100085788 3300005471 Bacteria 3135
11 Ga0070698_100097732 3300005471 Bacteria 2912
12 Ga0070699_100001759 3300005518 Bacteria 19742
13 Ga0070699_100018387 3300005518 Bacteria 6004
14 Ga0070679_100020086 3300005530 Bacteria 6510
15 Ga0070697_100237192 3300005536 Bacteria 1557
16 Ga0068857_100002919 3300005577 Bacteria 14091
17 Ga0081539_10008948 3300005985 Bacteria 8532
18 Ga0075433_10023745 3300006852 Bacteria 5164
19 Ga0075434_100181994 3300006871 Bacteria 2122
20 Ga0075429_100037928 3300006880 Bacteria 4195
21 Ga0075429_100082646 3300006880 Bacteria 2799
22 Ga0075429_100104870 3300006880 Bacteria 2469
23 Ga0075429_100248773 3300006880 Bacteria 1557
24 Ga0075435_100055922 3300007076 Bacteria 3189
25 Ga0099794_10005284 3300007265 Bacteria 5167
26 Ga0099795_10023869 3300007788 Bacteria 2033
27 Ga0114129_10001496 3300009147 Bacteria 31625
28 Ga0114129_10016014 3300009147 Bacteria 10664
29 Ga0114129_10056405 3300009147 Bacteria 5502
30 Ga0114129_10091049 3300009147 Bacteria 4227
31 Ga0114129_10153497 3300009147 Bacteria 3151
32 Ga0114129_10168491 3300009147 Bacteria 2987
33 Ga0114129_10274401 3300009147 Bacteria 2255
34 Ga0114129_10397605 3300009147 Bacteria 1816
35 Ga0114129_10465546 3300009147 Bacteria 1656
36 Ga0105243_10050753 3300009148 Bacteria 3279
37 Ga0105239_10115654 3300010375 Bacteria 2976
38 Ga0157369_10034890 3300013105 Bacteria 5518
39 Ga0157372_10087319 3300013307 Bacteria 3539
40 Ga0206349_1031334 3300020075 Bacteria 10560
41 Ga0206352_10219845 3300020078 Bacteria 6023
42 Ga0206350_10642857 3300020080 Bacteria 6259
43 Ga0213872_10005723 3300021361 Bacteria 6330
44 Ga0213871_10003129 3300021441 Bacteria 3147
45 Ga0224712_10000054 3300022467 Bacteria 17217
46 Ga0207660_10155694 3300025917 Bacteria 1759
47 Ga0207709_10034876 3300025935 Bacteria 2970
48 Ga0207708_10184818 3300026075 Bacteria 1656
49 Ga0207674_10006339 3300026116 Bacteria 13927
50 Ga0265326_10004131 3300028558 Bacteria 4684
51 Ga0265318_10006344 3300028577 Bacteria 5456
52 Ga0265318_10006841 3300028577 Bacteria 5213
53 Ga0265323_10013631 3300028653 Bacteria 3237
54 Ga0265322_10014882 3300028654 Bacteria 2248
55 Ga0265338_10029339 3300028800 Bacteria 5454
56 Ga0265338_10030555 3300028800 Bacteria 5303
57 Ga0265330_10000034 3300031235 Bacteria 123933
58 Ga0265330_10012677 3300031235 Bacteria 3938
59 Ga0265332_10000559 3300031238 Bacteria 25019
60 Ga0265328_10007698 3300031239 Bacteria 4479
61 Ga0265320_10082946 3300031240 Unclassified 1494
62 Ga0265316_10000078 3300031344 Bacteria 101128
63 Ga0265316_10000093 3300031344 Bacteria 95937
64 Ga0265316_10000185 3300031344 Bacteria 71392
65 Ga0265316_10010403 3300031344 Bacteria 8481
66 Ga0265316_10012931 3300031344 Bacteria 7448
67 Ga0265316_10024303 3300031344 Bacteria 5082
68 Ga0316575_10028234 3300031665 Bacteria 2187
69 Ga0265314_10000112 3300031711 Bacteria 124291
70 Ga0265342_10000242 3300031712 Bacteria 61326
71 Ga0265342_10030237 3300031712 Bacteria 3357
72 Ga0265342_10034534 3300031712 Bacteria 3102
73 Ga0316576_10154804 3300031727 Bacteria 1728
74 Ga0316577_10007109 3300031733 Bacteria 5955
75 Ga0316577_10024073 3300031733 Bacteria 3384
76 Ga0307409_100022061 3300031995 Bacteria 4382
77 Ga0316574_0007138 3300035398 Bacteria 6105
78 Ga0316582_0011412 3300036647 Bacteria 4910
79 Ga0316582_0016094 3300036647 Bacteria 4294
80 Ga0316584_0015053 3300036712 Bacteria 5526
81 Ga0316584_0017188 3300036712 Bacteria 5195
82 Ga0316584_0023039 3300036712 Bacteria 4547
83 Ga0436360_0746999 3300039438 Bacteria 7727
84 Ga0436360_1301088 3300039438 Bacteria 2388
85 Ga0436361_0788453 3300039447 Bacteria 15739
86 Ga0436361_0962723 3300039447 Bacteria 26082
87 Ga0436363_0666094 3300039450 Bacteria 7788
88 Ga0436363_1342554 3300039450 Bacteria 9036
89 Ga0436362_0748817 3300039453 Bacteria 5439
90 Ga0451577_0001325 3300042876 Bacteria 33718
91 Ga0451577_0002891 3300042876 Bacteria 19729
92 Ga0451577_0003280 3300042876 Bacteria 18210
93 Ga0451577_0010434 3300042876 Bacteria 8883
94 Ga0451577_0022076 3300042876 Bacteria 5815
95 Ga0451577_0045605 3300042876 Bacteria 3924
96 Ga0451577_0134755 3300042876 Bacteria 2217
97 Ga0451577_0169661 3300042876 Bacteria 1966
98 Ga0451577_0213813 3300042876 Bacteria 1742
99 Ga0453683_0002544 3300044673 Bacteria 14058
100 Ga0453683_0020919 3300044673 Bacteria 4179
101 Ga0453683_0042859 3300044673 Bacteria 2841
102 Ga0453683_0088760 3300044673 Bacteria 1938
103 Ga0466961_0018567 3300044693 Bacteria 4476
104 Ga0453684_0000012 3300044712 Bacteria 1062512
105 Ga0453684_0000164 3300044712 Bacteria 296093
106 Ga0453684_0001339 3300044712 Bacteria 72274
107 Ga0453684_0001379 3300044712 Bacteria 70338
108 Ga0453684_0002219 3300044712 Bacteria 48222
109 Ga0453684_0003794 3300044712 Bacteria 33345
110 Ga0453684_0004002 3300044712 Bacteria 32129
111 Ga0453684_0006856 3300044712 Bacteria 21403
112 Ga0453684_0008510 3300044712 Bacteria 18342
113 Ga0453684_0009447 3300044712 Bacteria 17058
114 Ga0453684_0024537 3300044712 Bacteria 8808
115 Ga0453684_0028684 3300044712 Bacteria 7929
116 Ga0453684_0036647 3300044712 Bacteria 6754
117 Ga0453684_0076774 3300044712 Bacteria 4192
118 Ga0453684_0101054 3300044712 Bacteria 3529
119 Ga0453684_0150698 3300044712 Bacteria 2764
120 Ga0453684_0176816 3300044712 Bacteria 2509
121 Ga0453684_0187977 3300044712 Bacteria 2418
122 Ga0453684_0220675 3300044712 Bacteria 2196
123 Ga0451576_0000152 3300045051 Bacteria 176305
124 Ga0451576_0000573 3300045051 Bacteria 78637
125 Ga0451576_0004000 3300045051 Bacteria 19619
126 Ga0451576_0005546 3300045051 Bacteria 15763
127 Ga0451576_0006045 3300045051 Bacteria 14944
128 Ga0451576_0018124 3300045051 Bacteria 7724
129 Ga0451576_0029285 3300045051 Bacteria 5892
130 Ga0451576_0096087 3300045051 Bacteria 3082
131 Ga0451576_0207086 3300045051 Bacteria 2048
132 Ga0466958_0010991 3300045836 Bacteria 5087
133 Ga0501071_0022655 3300049587 Bacteria 4381
134 Ga0501075_0009313 3300049591 Bacteria 6873
135 Ga0501076_0024541 3300049592 Bacteria 4661
136 Ga0501081_0130958 3300049743 Bacteria 1792
137 nmdc:mga05p37_107968_c2 3300050507 Bacteria 3046
138 nmdc:mga05p37_13240_c1 3300050507 Bacteria 9874
139 nmdc:mga05p37_2543_c1 3300050507 Bacteria 21204
140 nmdc:mga05p37_4958_c1 3300050507 Bacteria 15596
141 nmdc:mga05p37_96877_c1 3300050507 Bacteria 3635
142 nmdc:mga08y16_56522_c1 3300050511 Bacteria 4100
143 nmdc:mga0n895_194187_c1 3300050512 Bacteria 2061
144 nmdc:mga0a205_106272_c1 3300050515 Bacteria 2705
145 nmdc:mga0a205_7803_c1 3300050515 Bacteria 9717
146 Ga0501084_0047913 3300054114 Bacteria 3579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0169661 Ga0451577_0169661_552_1931 458
2 3300044712 Ga0453684_0101054 Ga0453684_0101054_27_1406 458
3 3300005445 Ga0070708_100050241 Ga0070708_1000502412 460
4 3300005530 Ga0070679_100020086 Ga0070679_1000200866 468
5 3300005577 Ga0068857_100002919 Ga0068857_1000029199 468
6 3300009147 Ga0114129_10091049 Ga0114129_100910493 468
7 3300022467 Ga0224712_10000054 Ga0224712_1000005415 468
8 3300026116 Ga0207674_10006339 Ga0207674_100063398 468
9 3300042876 Ga0451577_0003280 Ga0451577_0003280_2484_3968 472
10 3300044712 Ga0453684_0000012 Ga0453684_0000012_863569_865053 472
11 3300039447 Ga0436361_0962723 Ga0436361_0962723_14690_16207 473
12 3300009147 Ga0114129_10016014 Ga0114129_100160146 475
13 3300031235 Ga0265330_10000034 Ga0265330_10000034123 475
14 3300031238 Ga0265332_10000559 Ga0265332_1000055924 475
15 3300031239 Ga0265328_10007698 Ga0265328_100076985 475
16 3300031240 Ga0265320_10082946 Ga0265320_100829461 475
17 3300031711 Ga0265314_10000112 Ga0265314_1000011230 475
18 3300031712 Ga0265342_10000242 Ga0265342_1000024248 475
19 3300050507 nmdc:mga05p37_13240_c1 nmdc:mga05p37_13240_c1_4362_5867 475
20 3300045051 Ga0451576_0000573 Ga0451576_0000573_72880_74568 476
21 3300031344 Ga0265316_10010403 Ga0265316_100104032 477
22 3300044693 Ga0466961_0018567 Ga0466961_0018567_1843_3354 481
23 3300039450 Ga0436363_0666094 Ga0436363_0666094_121_1650 483
24 3300039453 Ga0436362_0748817 Ga0436362_0748817_60_1589 483
25 3300006852 Ga0075433_10023745 Ga0075433_100237454 484
26 3300007076 Ga0075435_100055922 Ga0075435_1000559222 484
27 3300009147 Ga0114129_10001496 Ga0114129_1000149615 484
28 3300031712 Ga0265342_10034534 Ga0265342_100345342 484
29 3300050507 nmdc:mga05p37_4958_c1 nmdc:mga05p37_4958_c1_11537_13150 484
30 3300050515 nmdc:mga0a205_7803_c1 nmdc:mga0a205_7803_c1_3269_4882 484
31 3300005536 Ga0070697_100237192 Ga0070697_1002371921 487
32 3300009147 Ga0114129_10274401 Ga0114129_102744012 487
33 3300031733 Ga0316577_10024073 Ga0316577_100240732 487
34 3300044712 Ga0453684_0220675 Ga0453684_0220675_418_1932 487
35 3300045051 Ga0451576_0096087 Ga0451576_0096087_735_2249 487
36 3300005445 Ga0070708_100206311 Ga0070708_1002063112 489
37 3300010375 Ga0105239_10115654 Ga0105239_101156541 489
38 3300013105 Ga0157369_10034890 Ga0157369_100348903 489
39 3300020075 Ga0206349_1031334 Ga0206349_10313349 489
40 3300020078 Ga0206352_10219845 Ga0206352_102198454 489
41 3300020080 Ga0206350_10642857 Ga0206350_106428572 489
42 3300021361 Ga0213872_10005723 Ga0213872_100057236 489
43 3300021441 Ga0213871_10003129 Ga0213871_100031292 489
44 3300039438 Ga0436360_0746999 Ga0436360_0746999_2173_3693 489
45 3300039438 Ga0436360_1301088 Ga0436360_1301088_365_1882 489
46 3300039447 Ga0436361_0788453 Ga0436361_0788453_4284_5801 489
47 3300039450 Ga0436363_1342554 Ga0436363_1342554_6182_7711 489
48 3300045836 Ga0466958_0010991 Ga0466958_0010991_3489_5030 489
49 3300005445 Ga0070708_100195758 Ga0070708_1001957582 490
50 3300013307 Ga0157372_10087319 Ga0157372_100873192 491
51 3300006871 Ga0075434_100181994 Ga0075434_1001819942 492
52 3300044673 Ga0453683_0042859 Ga0453683_0042859_147_1646 492
53 3300050512 nmdc:mga0n895_194187_c1 nmdc:mga0n895_194187_c1_446_2011 492
54 3300005467 Ga0070706_100092409 Ga0070706_1000924092 493
55 3300028558 Ga0265326_10004131 Ga0265326_100041313 493
56 3300028654 Ga0265322_10014882 Ga0265322_100148822 493
57 3300028800 Ga0265338_10029339 Ga0265338_100293392 493
58 3300031235 Ga0265330_10012677 Ga0265330_100126772 493
59 3300031344 Ga0265316_10000078 Ga0265316_1000007810 493
60 3300031344 Ga0265316_10000093 Ga0265316_1000009336 493
61 3300031344 Ga0265316_10024303 Ga0265316_100243033 493
62 3300031995 Ga0307409_100022061 Ga0307409_1000220613 493
63 3300031344 Ga0265316_10000185 Ga0265316_1000018536 494
64 3300031344 Ga0265316_10012931 Ga0265316_100129313 494
65 3300031712 Ga0265342_10030237 Ga0265342_100302373 494
66 3300042876 Ga0451577_0002891 Ga0451577_0002891_11923_13428 494
67 3300042876 Ga0451577_0010434 Ga0451577_0010434_6310_7932 494
68 3300042876 Ga0451577_0213813 Ga0451577_0213813_40_1545 494
69 3300044712 Ga0453684_0028684 Ga0453684_0028684_4423_5928 494
70 3300044712 Ga0453684_0036647 Ga0453684_0036647_1984_3609 494
71 3300045051 Ga0451576_0006045 Ga0451576_0006045_9691_11313 494
72 3300045051 Ga0451576_0029285 Ga0451576_0029285_2033_3538 494
73 3300028577 Ga0265318_10006344 Ga0265318_100063442 495
74 3300044673 Ga0453683_0020919 Ga0453683_0020919_321_1946 495
75 3300044712 Ga0453684_0000164 Ga0453684_0000164_187853_189340 495
76 3300044712 Ga0453684_0001379 Ga0453684_0001379_39064_40551 495
77 3300044712 Ga0453684_0004002 Ga0453684_0004002_24561_26081 495
78 3300044712 Ga0453684_0076774 Ga0453684_0076774_1279_2895 495
79 3300045051 Ga0451576_0207086 Ga0451576_0207086_178_1665 495
80 3300044712 Ga0453684_0008510 Ga0453684_0008510_3110_4747 496
81 3300005471 Ga0070698_100097732 Ga0070698_1000977322 497
82 3300005518 Ga0070699_100018387 Ga0070699_1000183874 497
83 3300042876 Ga0451577_0001325 Ga0451577_0001325_6250_7743 497
84 3300042876 Ga0451577_0022076 Ga0451577_0022076_3277_4914 497
85 3300044673 Ga0453683_0002544 Ga0453683_0002544_2217_3731 497
86 3300044712 Ga0453684_0003794 Ga0453684_0003794_22041_23534 497
87 3300044712 Ga0453684_0006856 Ga0453684_0006856_13609_15141 497
88 3300044712 Ga0453684_0009447 Ga0453684_0009447_11713_13206 497
89 3300044712 Ga0453684_0024537 Ga0453684_0024537_4090_5613 497
90 3300044712 Ga0453684_0150698 Ga0453684_0150698_1180_2694 497
91 3300044712 Ga0453684_0176816 Ga0453684_0176816_696_2213 497
92 3300045051 Ga0451576_0004000 Ga0451576_0004000_5962_7476 497
93 3300025917 Ga0207660_10155694 Ga0207660_101556941 498
94 3300042876 Ga0451577_0045605 Ga0451577_0045605_838_2376 498
95 3300045051 Ga0451576_0005546 Ga0451576_0005546_11876_13405 498
96 3300045051 Ga0451576_0018124 Ga0451576_0018124_5955_7493 498
97 3300007265 Ga0099794_10005284 Ga0099794_100052842 500
98 3300007788 Ga0099795_10023869 Ga0099795_100238692 500
99 3300028800 Ga0265338_10030555 Ga0265338_100305552 500
100 3300031733 Ga0316577_10007109 Ga0316577_100071093 500
101 3300036712 Ga0316584_0015053 Ga0316584_0015053_3209_4741 500
102 3300036712 Ga0316584_0017188 Ga0316584_0017188_2220_3722 500
103 3300036647 Ga0316582_0011412 Ga0316582_0011412_2170_3684 501
104 3300044712 Ga0453684_0001339 Ga0453684_0001339_50097_51611 501
105 3300028653 Ga0265323_10013631 Ga0265323_100136312 502
106 3300031665 Ga0316575_10028234 Ga0316575_100282342 502
107 3300031727 Ga0316576_10154804 Ga0316576_101548041 502
108 3300035398 Ga0316574_0007138 Ga0316574_0007138_2770_4293 502
109 3300036647 Ga0316582_0016094 Ga0316582_0016094_1484_3007 502
110 3300036712 Ga0316584_0023039 Ga0316584_0023039_869_2392 502
111 3300005518 Ga0070699_100001759 Ga0070699_1000017597 503
112 3300006880 Ga0075429_100037928 Ga0075429_1000379282 503
113 3300006880 Ga0075429_100248773 Ga0075429_1002487731 503
114 3300009147 Ga0114129_10056405 Ga0114129_100564052 503
115 3300009147 Ga0114129_10168491 Ga0114129_101684912 503
116 3300042876 Ga0451577_0134755 Ga0451577_0134755_143_1654 503
117 3300044712 Ga0453684_0187977 Ga0453684_0187977_660_2171 503
118 3300045051 Ga0451576_0000152 Ga0451576_0000152_140715_142235 503
119 3300006880 Ga0075429_100082646 Ga0075429_1000826462 505
120 3300009147 Ga0114129_10465546 Ga0114129_104655461 505
121 3300044673 Ga0453683_0088760 Ga0453683_0088760_239_1849 506
122 3300049743 Ga0501081_0130958 Ga0501081_0130958_65_1591 506
123 3300050507 nmdc:mga05p37_2543_c1 nmdc:mga05p37_2543_c1_11632_13152 506
124 3300005289 Ga0065704_10008345 Ga0065704_100083452 508
125 3300005289 Ga0065704_10073492 Ga0065704_100734921 508
126 3300005289 Ga0065704_10115200 Ga0065704_101152002 508
127 3300005295 Ga0065707_10090618 Ga0065707_100906184 508
128 3300005444 Ga0070694_100025184 Ga0070694_1000251842 508
129 3300005471 Ga0070698_100085788 Ga0070698_1000857882 508
130 3300005985 Ga0081539_10008948 Ga0081539_100089487 508
131 3300006880 Ga0075429_100104870 Ga0075429_1001048701 508
132 3300009147 Ga0114129_10153497 Ga0114129_101534972 508
133 3300009147 Ga0114129_10397605 Ga0114129_103976052 508
134 3300009148 Ga0105243_10050753 Ga0105243_100507532 508
135 3300025935 Ga0207709_10034876 Ga0207709_100348762 508
136 3300026075 Ga0207708_10184818 Ga0207708_101848181 508
137 3300028577 Ga0265318_10006841 Ga0265318_100068415 508
138 3300044712 Ga0453684_0002219 Ga0453684_0002219_22849_24405 508
139 3300049587 Ga0501071_0022655 Ga0501071_0022655_1384_2910 508
140 3300049591 Ga0501075_0009313 Ga0501075_0009313_620_2146 508
141 3300049592 Ga0501076_0024541 Ga0501076_0024541_922_2448 508
142 3300050507 nmdc:mga05p37_107968_c2 nmdc:mga05p37_107968_c2_425_1957 508
143 3300050507 nmdc:mga05p37_96877_c1 nmdc:mga05p37_96877_c1_1939_3465 508
144 3300050511 nmdc:mga08y16_56522_c1 nmdc:mga08y16_56522_c1_2293_3819 508
145 3300050515 nmdc:mga0a205_106272_c1 nmdc:mga0a205_106272_c1_1081_2613 508
146 3300054114 Ga0501084_0047913 Ga0501084_0047913_1531_3057 508

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

134

431

0.94

PF01059

Oxidored_q5_N

NADH-ubiquinone oxidoreductase chain 4, amino terminus

12

131

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e73-assembly1.cif.gz_4M vigna radiata supercomplex i+iii2 (full bridge) 0.9771 8 499
8beh-assembly1.cif.gz_M cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane tip) 0.975 270 498
7ar7-assembly1.cif.gz_M cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.9719 8 499
6hum-assembly1.cif.gz_D structure of the photosynthetic complex i from thermosynechococcus elongatus 0.9699 8 498
8e73-assembly1.cif.gz_4M vigna radiata supercomplex i+iii2 (full bridge) 0.9632 8 499
ID Description Score Start End Superfamily
af_M1FQK6_1_136_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9562 11 134 1.20.1070.10
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9363 6 132 1.20.1070.10
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8948 6 132 1.20.1070.10
af_M1FQK6_1_136_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8547 11 134 1.20.1070.10
af_P0AFE8_1_132_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8313 8 132 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7Y2PBL1-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9895 278 498 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-K1YWP4-F1-model_v4 Proton-translocating NADH-quinone oxidoreductase, chain M 0.9874 82 500 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A520ZVG9-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9842 223 500 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A1Y5EAY4-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9832 1 500 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A7V9NRB8-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9816 242 500 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039

Feature Viewer

pLDDT pTM Quality
92.7 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map