F197486

General Info

Members Datasets Scaffolds Average Seq Length
146 95 292 441

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10055296|Ga0105242_100552962
Length 472
Sequence MSPAGGNPALQSHAVAITFCQVGFLHMKRRLIYGVVVVALGLNLFIGARIYLNTAQAAEKDSAYPSLELFSYVMERVRKDYVDGGKLTYQDLVYGALKGMLNTLDPHSEFMEPDKYKELQNDTQGAFGGLGIVISMKDNFVTVVSPMEDTPGFRAGILSGDRIVKIDNRSTERMSLQDAVKNLRGDPGTDVKITILRPSSGMIKDLKLTRAVINIDMVKDINGKKEFPLGENKIGYVRLVQFGERTSDDLEKALKKLKSQGMQALVLDLRWNPGGLLEQAVDVCEKFLPHGSLVVKTEGRDPKSSQNSVRKAMGRGDELHNMPMVILVNLGSASASEIVAGCLQDWKRAIVLGEKTFGKGSVQSILPLSDGSALRLTTAKYYTPSHKVIHEEGITPDILVPITDEEERDILMQRTPGGIESLDEKDRDRIAHAHDPQLDRAMDLLKGINLFAQRAPAPDKRVAQGTKEAAAQ

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
53 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
81 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
82 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
90 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
95 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.11
Nodule 0
Rhizoplane 1.37
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10055296 3300009176 Bacteria 3247
2 Ga0065707_10126088 3300005295 Bacteria 2010
3 Ga0070670_100083197 3300005331 Bacteria 2750
4 Ga0070689_100000199 3300005340 Bacteria 35970
5 Ga0070691_10093011 3300005341 Bacteria 1489
6 Ga0070667_100273106 3300005367 Bacteria 1516
7 Ga0070714_100237625 3300005435 Bacteria 1681
8 Ga0070713_100030536 3300005436 Bacteria 4280
9 Ga0070705_100106874 3300005440 Bacteria 1780
10 Ga0070694_100011545 3300005444 Bacteria 5470
11 Ga0070681_10028661 3300005458 Bacteria 5598
12 Ga0070681_10215603 3300005458 Bacteria 1836
13 Ga0070685_10044073 3300005466 Bacteria 2553
14 Ga0070685_10091887 3300005466 Bacteria 1838
15 Ga0070707_100086282 3300005468 Bacteria 3035
16 Ga0070707_100173046 3300005468 Bacteria 2104
17 Ga0070707_100219934 3300005468 Bacteria 1850
18 Ga0070698_100003989 3300005471 Bacteria 16245
19 Ga0070698_100007301 3300005471 Bacteria 11965
20 Ga0070699_100032245 3300005518 Bacteria 4523
21 Ga0070699_100075041 3300005518 Bacteria 2943
22 Ga0070697_100007033 3300005536 Bacteria 8747
23 Ga0070697_100007740 3300005536 Bacteria 8365
24 Ga0068857_100194255 3300005577 Bacteria 1849
25 Ga0068857_100245624 3300005577 Unclassified 1640
26 Ga0068856_100147620 3300005614 Bacteria 2359
27 Ga0068859_100029963 3300005617 Bacteria 5459
28 Ga0068859_100164466 3300005617 Unclassified 2298
29 Ga0068859_100202647 3300005617 Bacteria 2069
30 Ga0068859_100387678 3300005617 Unclassified 1493
31 Ga0068864_100016965 3300005618 Bacteria 6066
32 Ga0068863_100052224 3300005841 Bacteria 3875
33 Ga0068858_100067053 3300005842 Unclassified 3324
34 Ga0068860_100017096 3300005843 Bacteria 7071
35 Ga0075362_10000062 3300006177 Bacteria 32237
36 Ga0097621_100129897 3300006237 Bacteria 2143
37 Ga0075370_10016191 3300006353 Bacteria 4008
38 Ga0097620_100029963 3300006931 Bacteria 5459
39 Ga0097620_100164465 3300006931 Unclassified 2298
40 Ga0097620_100202651 3300006931 Bacteria 2069
41 Ga0097620_100387661 3300006931 Unclassified 1493
42 Ga0099795_10038055 3300007788 Bacteria 1696
43 Ga0105240_10034087 3300009093 Bacteria 6571
44 Ga0105240_10037500 3300009093 Bacteria 6229
45 Ga0105240_10084106 3300009093 Bacteria 3902
46 Ga0111539_10109432 3300009094 Bacteria 3243
47 Ga0111539_10137201 3300009094 Bacteria 2864
48 Ga0105245_10092588 3300009098 Bacteria 2784
49 Ga0105245_10235026 3300009098 Bacteria 1774
50 Ga0105248_10306902 3300009177 Bacteria 1787
51 Ga0157371_10042227 3300013102 Unclassified 3250
52 Ga0157374_10194322 3300013296 Bacteria 1986
53 Ga0157378_10246486 3300013297 Unclassified 1709
54 Ga0157372_10236109 3300013307 Unclassified 2121
55 Ga0157375_10000494 3300013308 Bacteria 35751
56 Ga0163163_10000085 3300014325 Bacteria 103280
57 Ga0163163_10014910 3300014325 Bacteria 7160
58 Ga0157376_10101125 3300014969 Unclassified 2519
59 Ga0213872_10003102 3300021361 Bacteria 9359
60 Ga0213874_10002474 3300021377 Bacteria 3983
61 Ga0213876_10000780 3300021384 Bacteria 21722
62 Ga0207707_10031428 3300025912 Unclassified 4646
63 Ga0207695_10138782 3300025913 Bacteria 2382
64 Ga0207652_10294474 3300025921 Bacteria 1464
65 Ga0207646_10039388 3300025922 Bacteria 4254
66 Ga0207700_10022869 3300025928 Bacteria 4296
67 Ga0207665_10124710 3300025939 Unclassified 1822
68 Ga0207641_10059333 3300026088 Bacteria 3258
69 Ga0207674_10010886 3300026116 Bacteria 10248
70 Ga0207674_10218236 3300026116 Bacteria 1855
71 Ga0268264_10000325 3300028381 Bacteria 75416
72 Ga0265337_1000195 3300028556 Bacteria 32084
73 Ga0265337_1000770 3300028556 Bacteria 16910
74 Ga0265323_10000453 3300028653 Bacteria 23261
75 Ga0265336_10000555 3300028666 Bacteria 21242
76 Ga0265338_10001539 3300028800 Bacteria 37247
77 Ga0265338_10001869 3300028800 Bacteria 33054
78 Ga0265338_10001975 3300028800 Bacteria 31933
79 Ga0265338_10002595 3300028800 Bacteria 26718
80 Ga0265338_10004200 3300028800 Bacteria 19644
81 Ga0265338_10004521 3300028800 Bacteria 18745
82 Ga0265338_10014412 3300028800 Bacteria 8800
83 Ga0265338_10081079 3300028800 Bacteria 2723
84 Ga0265338_10102016 3300028800 Bacteria 2334
85 Ga0265320_10000319 3300031240 Bacteria 39222
86 Ga0265320_10001394 3300031240 Bacteria 17567
87 Ga0265339_10004172 3300031249 Bacteria 9918
88 Ga0265339_10014688 3300031249 Bacteria 4714
89 Ga0265316_10000862 3300031344 Bacteria 33378
90 Ga0265316_10012323 3300031344 Bacteria 7674
91 Ga0265316_10054930 3300031344 Bacteria 3117
92 Ga0265314_10000079 3300031711 Bacteria 144215
93 Ga0265314_10062301 3300031711 Bacteria 2536
94 Ga0373935_0044216 3300035692 Bacteria 2806
95 Ga0373927_0005289 3300035695 Bacteria 8915
96 Ga0373937_0022390 3300036401 Bacteria 5681
97 Ga0373925_0001597 3300037068 Bacteria 19152
98 Ga0436365_0107951 3300039437 Bacteria 46156
99 Ga0436365_1358678 3300039437 Bacteria 9696
100 Ga0436360_0379595 3300039438 Bacteria 1685
101 Ga0436360_0774535 3300039438 Bacteria 3164
102 Ga0436360_1087485 3300039438 Bacteria 6028
103 Ga0436361_0028438 3300039447 Bacteria 7782
104 Ga0436361_0163252 3300039447 Bacteria 10507
105 Ga0436361_0199782 3300039447 Bacteria 5820
106 Ga0436361_0852676 3300039447 Bacteria 5754
107 Ga0436361_0914244 3300039447 Bacteria 5529
108 Ga0436363_0903439 3300039450 Bacteria 8470
109 Ga0436362_0437681 3300039453 Bacteria 6963
110 Ga0451577_0000846 3300042876 Bacteria 45685
111 Ga0451577_0013290 3300042876 Bacteria 7712
112 Ga0451577_0149704 3300042876 Unclassified 2100
113 Ga0453684_0000427 3300044712 Bacteria 171941
114 Ga0453684_0004340 3300044712 Bacteria 30131
115 Ga0453684_0027207 3300044712 Bacteria 8211
116 Ga0453684_0092220 3300044712 Bacteria 3735
117 Ga0453684_0256849 3300044712 Bacteria 2004
118 Ga0451576_0071709 3300045051 Bacteria 3606
119 Ga0495592_0000054 3300046454 Bacteria 107373
120 Ga0495641_0042460 3300046461 Unclassified 2107
121 Ga0495582_0036601 3300046473 Unclassified 2700
122 Ga0495662_0024495 3300046476 Bacteria 2912
123 Ga0495664_0028965 3300046477 Bacteria 3237
124 Ga0495618_0009956 3300046514 Bacteria 5750
125 Ga0495628_0000056 3300046516 Bacteria 89432
126 Ga0495630_0000067 3300046517 Bacteria 84296
127 Ga0495630_0003661 3300046517 Bacteria 10715
128 Ga0495630_0061917 3300046517 Bacteria 2811
129 Ga0495586_0000028 3300046535 Bacteria 97992
130 Ga0495586_0088699 3300046535 Bacteria 1706
131 Ga0495645_0065410 3300046543 Bacteria 2630
132 Ga0495599_0064177 3300046678 Bacteria 2294
133 Ga0495658_0010451 3300046683 Bacteria 4644
134 Ga0495658_0066504 3300046683 Unclassified 2082
135 Ga0495613_0005332 3300046689 Bacteria 9655
136 Ga0495680_0010326 3300047322 Bacteria 8332
137 Ga0495675_0017083 3300047444 Bacteria 4595
138 Ga0496107_0142419 3300048910 Bacteria 1772
139 Ga0496115_0024493 3300048918 Bacteria 4692
140 nmdc:mga03683_63_c1 3300050489 Bacteria 41164
141 nmdc:mga07m45_3527_c2 3300050496 Bacteria 5214
142 nmdc:mga06r32_5762_c1 3300050510 Bacteria 11162
143 nmdc:mga08y16_149164_c1 3300050511 Bacteria 2431
144 nmdc:mga0rr50_123493_c1 3300050513 Unclassified 2064
145 Ga0500555_000271 3300053103 Bacteria 22309
146 Ga0500556_0000010 3300053104 Bacteria 258288
147 Ga0105242_10055296
148 Ga0065707_10126088
149 Ga0070670_100083197
150 Ga0070689_100000199
151 Ga0070691_10093011
152 Ga0070667_100273106
153 Ga0070714_100237625
154 Ga0070713_100030536
155 Ga0070705_100106874
156 Ga0070694_100011545
157 Ga0070681_10028661
158 Ga0070681_10215603
159 Ga0070685_10044073
160 Ga0070685_10091887
161 Ga0070707_100086282
162 Ga0070707_100173046
163 Ga0070707_100219934
164 Ga0070698_100003989
165 Ga0070698_100007301
166 Ga0070699_100032245
167 Ga0070699_100075041
168 Ga0070697_100007033
169 Ga0070697_100007740
170 Ga0068857_100194255
171 Ga0068857_100245624
172 Ga0068856_100147620
173 Ga0068859_100029963
174 Ga0068859_100164466
175 Ga0068859_100202647
176 Ga0068859_100387678
177 Ga0068864_100016965
178 Ga0068863_100052224
179 Ga0068858_100067053
180 Ga0068860_100017096
181 Ga0075362_10000062
182 Ga0097621_100129897
183 Ga0075370_10016191
184 Ga0097620_100029963
185 Ga0097620_100164465
186 Ga0097620_100202651
187 Ga0097620_100387661
188 Ga0099795_10038055
189 Ga0105240_10034087
190 Ga0105240_10037500
191 Ga0105240_10084106
192 Ga0111539_10109432
193 Ga0111539_10137201
194 Ga0105245_10092588
195 Ga0105245_10235026
196 Ga0105248_10306902
197 Ga0157371_10042227
198 Ga0157374_10194322
199 Ga0157378_10246486
200 Ga0157372_10236109
201 Ga0157375_10000494
202 Ga0163163_10000085
203 Ga0163163_10014910
204 Ga0157376_10101125
205 Ga0213872_10003102
206 Ga0213874_10002474
207 Ga0213876_10000780
208 Ga0207707_10031428
209 Ga0207695_10138782
210 Ga0207652_10294474
211 Ga0207646_10039388
212 Ga0207700_10022869
213 Ga0207665_10124710
214 Ga0207641_10059333
215 Ga0207674_10010886
216 Ga0207674_10218236
217 Ga0268264_10000325
218 Ga0265337_1000195
219 Ga0265337_1000770
220 Ga0265323_10000453
221 Ga0265336_10000555
222 Ga0265338_10001539
223 Ga0265338_10001869
224 Ga0265338_10001975
225 Ga0265338_10002595
226 Ga0265338_10004200
227 Ga0265338_10004521
228 Ga0265338_10014412
229 Ga0265338_10081079
230 Ga0265338_10102016
231 Ga0265320_10000319
232 Ga0265320_10001394
233 Ga0265339_10004172
234 Ga0265339_10014688
235 Ga0265316_10000862
236 Ga0265316_10012323
237 Ga0265316_10054930
238 Ga0265314_10000079
239 Ga0265314_10062301
240 Ga0373935_0044216
241 Ga0373927_0005289
242 Ga0373937_0022390
243 Ga0373925_0001597
244 Ga0436365_0107951
245 Ga0436365_1358678
246 Ga0436360_0379595
247 Ga0436360_0774535
248 Ga0436360_1087485
249 Ga0436361_0028438
250 Ga0436361_0163252
251 Ga0436361_0199782
252 Ga0436361_0852676
253 Ga0436361_0914244
254 Ga0436363_0903439
255 Ga0436362_0437681
256 Ga0451577_0000846
257 Ga0451577_0013290
258 Ga0451577_0149704
259 Ga0453684_0000427
260 Ga0453684_0004340
261 Ga0453684_0027207
262 Ga0453684_0092220
263 Ga0453684_0256849
264 Ga0451576_0071709
265 Ga0495592_0000054
266 Ga0495641_0042460
267 Ga0495582_0036601
268 Ga0495662_0024495
269 Ga0495664_0028965
270 Ga0495618_0009956
271 Ga0495628_0000056
272 Ga0495630_0000067
273 Ga0495630_0003661
274 Ga0495630_0061917
275 Ga0495586_0000028
276 Ga0495586_0088699
277 Ga0495645_0065410
278 Ga0495599_0064177
279 Ga0495658_0010451
280 Ga0495658_0066504
281 Ga0495613_0005332
282 Ga0495680_0010326
283 Ga0495675_0017083
284 Ga0496107_0142419
285 Ga0496115_0024493
286 nmdc:mga03683_63_c1
287 nmdc:mga07m45_3527_c2
288 nmdc:mga06r32_5762_c1
289 nmdc:mga08y16_149164_c1
290 nmdc:mga0rr50_123493_c1
291 Ga0500555_000271
292 Ga0500556_0000010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17820

PDZ_6

PDZ domain

142

197

0.97

PF03572

Peptidase_S41

Peptidase family S41

233

400

0.93

PF00595

PDZ

PDZ domain

120

196

0.9

PF13180

PDZ_2

PDZ domain

128

209

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o46-assembly1.cif.gz_A crystal structure of the pdz domain of mpp7 0.9205 94 149
6nid-assembly1.cif.gz_A crystal structure of a human calcium/calmodulin dependent serine protein kinase (cask) pdz domain in complex with neurexin-1 peptide 0.9078 94 149
7ntk-assembly2.cif.gz_B pals1 pdz1 domain with sars-cov-2_e pbm complex 0.9052 96 149
6bxg-assembly1.cif.gz_A 1.45 angstrom resolution crystal structure of pdz domain of carboxy-terminal protease from vibrio cholerae in complex with peptide. 0.8969 93 181
2f5y-assembly2.cif.gz_B crystal structure of the pdz domain from human rgs-3 0.8897 95 163
ID Description Score Start End Superfamily
af_Q5ZA08_147_239_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9497 95 179 2.30.42.10
af_O23614_210_301_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9368 95 181 2.30.42.10
1fc6A02 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.929 95 181 2.30.42.10
5g1dB01 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9203 96 149 2.30.42.10
af_A0A3B1DQX2_377_473_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9196 96 147 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A2E5T0W1-F1-model_v4 PDZ domain-containing protein 0.9647 92 181 GO:0004175
GO:0007165
GO:0016020
GO:0030288
AF-A0A7S4LZN8-F1-model_v4 PDZ domain-containing protein 0.9541 92 177
AF-A0A7S1HAU4-F1-model_v4 PDZ domain-containing protein 0.9468 90 177
AF-A0A7S0TP60-F1-model_v4 PDZ domain-containing protein 0.9464 92 179
AF-A0A512NQH1-F1-model_v4 PDZ domain-containing protein 0.9456 94 181

Map