F197065

General Info

Members Datasets Scaffolds Average Seq Length
146 76 292 256

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100498616|Ga0068854_1004986162
Length 278
Sequence LRNRVITAQPFFLAIKVAATMARYQLTLVYDGTNFFGSQRQAKSRTVQGELEKALRKLGWSGRSVIISGRTDTGVHATGQVASVDLDWSHTDSDLIRALNAALPADMSVQETRMVPAKFHPRFDAQSRRYRYRLFCQSLRDPIRERFAWRVWPGVDGDILPDTAKLFLGTHDFSAFGCPTSPKGTTVRTVMKAEWMQAEQDGWHFEVQANAFLYRMVRRLVFVQVAVAQGKLSTEAITGSLAQQAKAGSRSEISAGLAPAHGLTLVEVTYPPLESIGQ

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
49 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
53 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
54 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
55 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
64 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
65 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
66 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
67 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
68 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
69 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
70 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
71 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
72 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
73 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
74 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
75 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
76 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.47
Metatranscriptomes 7.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100498616 3300005578 Bacteria 1025
2 Ga0065704_10077140 3300005289 Bacteria 4840
3 Ga0065707_10082110 3300005295 Bacteria 21594
4 Ga0065707_10085511 3300005295 Bacteria 6099
5 Ga0070694_100100160 3300005444 Bacteria 2049
6 Ga0070706_100033241 3300005467 Bacteria 4760
7 Ga0070706_100100349 3300005467 Bacteria 2689
8 Ga0070707_100201225 3300005468 Bacteria 1941
9 Ga0070698_100132224 3300005471 Bacteria 2450
10 Ga0070699_100002160 3300005518 Bacteria 17784
11 Ga0070696_100082079 3300005546 Bacteria 2285
12 Ga0070704_100033989 3300005549 Bacteria 3453
13 Ga0068859_100269460 3300005617 Bacteria 1795
14 Ga0068864_100422144 3300005618 Bacteria 1271
15 Ga0068861_100210643 3300005719 Bacteria 1637
16 Ga0068858_100270991 3300005842 Bacteria 1615
17 Ga0068862_100166100 3300005844 Bacteria 1973
18 Ga0081539_10003413 3300005985 Bacteria 19564
19 Ga0081539_10115503 3300005985 Bacteria 1343
20 Ga0075428_100004783 3300006844 Bacteria 15000
21 Ga0075428_100022609 3300006844 Bacteria 6961
22 Ga0075428_100290749 3300006844 Bacteria 1758
23 Ga0075430_100178771 3300006846 Bacteria 1765
24 Ga0075431_100003767 3300006847 Bacteria 14739
25 Ga0075433_10024641 3300006852 Bacteria 5081
26 Ga0075434_100151801 3300006871 Bacteria 2337
27 Ga0075429_100011278 3300006880 Bacteria 7736
28 Ga0075429_100028742 3300006880 Bacteria 4829
29 Ga0075429_100054334 3300006880 Bacteria 3484
30 Ga0075429_100146337 3300006880 Bacteria 2068
31 Ga0075429_100317393 3300006880 Bacteria 1364
32 Ga0097620_100269454 3300006931 Bacteria 1795
33 Ga0111539_10024178 3300009094 Bacteria 7460
34 Ga0114129_10002710 3300009147 Bacteria 24665
35 Ga0114129_10017603 3300009147 Bacteria 10172
36 Ga0114129_10031948 3300009147 Bacteria 7443
37 Ga0114129_10045348 3300009147 Bacteria 6181
38 Ga0105243_10294420 3300009148 Bacteria 1468
39 Ga0105243_10527115 3300009148 Bacteria 1124
40 Ga0105249_10006480 3300009553 Bacteria 10182
41 Ga0105246_10026434 3300011119 Bacteria 3792
42 Ga0207653_10021939 3300025885 Bacteria 2027
43 Ga0207643_10045961 3300025908 Bacteria 2467
44 Ga0207660_10292531 3300025917 Bacteria 1295
45 Ga0207646_10177208 3300025922 Bacteria 1925
46 Ga0207670_10028054 3300025936 Bacteria 3568
47 Ga0207712_10366376 3300025961 Bacteria 1202
48 Ga0207703_10264954 3300026035 Bacteria 1554
49 Ga0207674_10124653 3300026116 Bacteria 2542
50 Ga0209968_1020658 3300027526 Bacteria 1065
51 Ga0268265_10542060 3300028380 Bacteria 1103
52 Ga0265323_10012034 3300028653 Bacteria 3476
53 Ga0265327_10091965 3300031251 Bacteria 1477
54 Ga0316575_10031182 3300031665 Bacteria 2086
55 Ga0307405_10325164 3300031731 Bacteria 1176
56 Ga0307413_10170411 3300031824 Bacteria 1540
57 Ga0307410_10137835 3300031852 Bacteria 1801
58 Ga0307409_100136641 3300031995 Bacteria 2105
59 Ga0307409_100275550 3300031995 Bacteria 1552
60 Ga0307416_100513203 3300032002 Bacteria 1265
61 Ga0307414_10342174 3300032004 Bacteria 1281
62 Ga0307411_10418036 3300032005 Bacteria 1113
63 Ga0316593_10000039 3300032168 Bacteria 14170
64 Ga0316593_10001041 3300032168 Bacteria 5769
65 Ga0316593_10003675 3300032168 Unclassified 3840
66 Ga0316593_10034114 3300032168 Bacteria 1669
67 Ga0316593_10069475 3300032168 Bacteria 1216
68 Ga0316593_10087920 3300032168 Bacteria 1092
69 Ga0316592_1010837 3300033524 Bacteria 1843
70 Ga0316592_1032920 3300033524 Bacteria 1132
71 Ga0316596_1009492 3300033541 Unclassified 2336
72 Ga0316596_1018606 3300033541 Bacteria 1757
73 Ga0316596_1056731 3300033541 Bacteria 1041
74 Ga0316574_0000425 3300035398 Bacteria 16756
75 Ga0316582_0078504 3300036647 Bacteria 2151
76 Ga0316582_0082937 3300036647 Unclassified 2097
77 Ga0316584_0013130 3300036712 Bacteria 5854
78 Ga0316584_0108178 3300036712 Bacteria 2080
79 Ga0316581_0006010 3300037588 Unclassified 3195
80 Ga0451577_0026654 3300042876 Bacteria 5234
81 Ga0451577_0028491 3300042876 Bacteria 5051
82 Ga0451577_0032968 3300042876 Bacteria 4668
83 Ga0451577_0109360 3300042876 Bacteria 2472
84 Ga0451577_0115417 3300042876 Bacteria 2404
85 Ga0451577_0185245 3300042876 Bacteria 1877
86 Ga0451577_0522358 3300042876 Bacteria 1078
87 Ga0451577_0522374 3300042876 Unclassified 1078
88 Ga0451577_0609131 3300042876 Bacteria 991
89 Ga0453683_0013294 3300044673 Bacteria 5379
90 Ga0453683_0135690 3300044673 Bacteria 1552
91 Ga0453683_0170150 3300044673 Bacteria 1380
92 Ga0453683_0183759 3300044673 Bacteria 1326
93 Ga0453683_0332325 3300044673 Bacteria 975
94 Ga0453683_0387019 3300044673 Unclassified 900
95 Ga0453684_0000055 3300044712 Bacteria 532014
96 Ga0453684_0000588 3300044712 Bacteria 135201
97 Ga0453684_0010317 3300044712 Bacteria 15993
98 Ga0453684_0011274 3300044712 Bacteria 15038
99 Ga0453684_0015585 3300044712 Bacteria 11997
100 Ga0453684_0025508 3300044712 Bacteria 8578
101 Ga0453684_0048493 3300044712 Bacteria 5615
102 Ga0453684_0158746 3300044712 Bacteria 2677
103 Ga0453684_0175549 3300044712 Bacteria 2520
104 Ga0453684_0178112 3300044712 Unclassified 2498
105 Ga0453684_0180919 3300044712 Unclassified 2475
106 Ga0453684_0188301 3300044712 Bacteria 2416
107 Ga0453684_0236687 3300044712 Bacteria 2105
108 Ga0453684_0460106 3300044712 Bacteria 1415
109 Ga0453684_0752767 3300044712 Bacteria 1054
110 Ga0453684_0756352 3300044712 Bacteria 1051
111 Ga0453684_0977155 3300044712 Bacteria 902
112 Ga0451576_0078616 3300045051 Bacteria 3432
113 Ga0451576_0090134 3300045051 Unclassified 3189
114 Ga0451576_0091748 3300045051 Bacteria 3159
115 Ga0451576_0112230 3300045051 Bacteria 2837
116 Ga0451576_0204325 3300045051 Bacteria 2063
117 Ga0451576_0403861 3300045051 Bacteria 1433
118 Ga0501031_0375428 3300049568 Bacteria 920
119 Ga0501038_0443061 3300049574 Bacteria 1000
120 Ga0501046_0072358 3300049580 Bacteria 2677
121 Ga0501073_0109236 3300049589 Bacteria 1919
122 Ga0501074_0042809 3300049590 Bacteria 3276
123 Ga0501075_0226322 3300049591 Bacteria 1426
124 Ga0501076_0016433 3300049592 Bacteria 5611
125 Ga0501079_0024440 3300049741 Bacteria 4636
126 Ga0501080_0100617 3300049742 Bacteria 2682
127 Ga0501081_0157581 3300049743 Bacteria 1634
128 Ga0501045_0186286 3300049824 Bacteria 1547
129 Ga0501045_0500321 3300049824 Bacteria 903
130 nmdc:mga05p37_292696_c1 3300050507 Bacteria 1938
131 nmdc:mga05p37_44854_c1 3300050507 Bacteria 5439
132 nmdc:mga05p37_4654_c1 3300050507 Bacteria 16043
133 nmdc:mga05p37_5158_c1 3300050507 Bacteria 15309
134 nmdc:mga05p37_9621_c1 3300050507 Bacteria 11450
135 nmdc:mga09592_125895_c1 3300050508 Bacteria 2202
136 nmdc:mga09592_24685_c1 3300050508 Bacteria 4972
137 nmdc:mga09592_267797_c1 3300050508 Bacteria 1482
138 nmdc:mga09592_44017_c1 3300050508 Bacteria 3756
139 nmdc:mga09592_54275_c2 3300050508 Bacteria 2236
140 nmdc:mga09592_94463_c1 3300050508 Bacteria 2557
141 nmdc:mga09592_9964_c1 3300050508 Bacteria 7731
142 nmdc:mga06r32_1022934_c1 3300050510 Bacteria 778
143 nmdc:mga06r32_34681_c1 3300050510 Bacteria 4759
144 nmdc:mga0n895_411493_c1 3300050512 Bacteria 1367
145 Ga0501084_0028743 3300054114 Bacteria 4649
146 Ga0501082_0136994 3300060353 Bacteria 2124
147 Ga0068854_100498616
148 Ga0065704_10077140
149 Ga0065707_10082110
150 Ga0065707_10085511
151 Ga0070694_100100160
152 Ga0070706_100033241
153 Ga0070706_100100349
154 Ga0070707_100201225
155 Ga0070698_100132224
156 Ga0070699_100002160
157 Ga0070696_100082079
158 Ga0070704_100033989
159 Ga0068859_100269460
160 Ga0068864_100422144
161 Ga0068861_100210643
162 Ga0068858_100270991
163 Ga0068862_100166100
164 Ga0081539_10003413
165 Ga0081539_10115503
166 Ga0075428_100004783
167 Ga0075428_100022609
168 Ga0075428_100290749
169 Ga0075430_100178771
170 Ga0075431_100003767
171 Ga0075433_10024641
172 Ga0075434_100151801
173 Ga0075429_100011278
174 Ga0075429_100028742
175 Ga0075429_100054334
176 Ga0075429_100146337
177 Ga0075429_100317393
178 Ga0097620_100269454
179 Ga0111539_10024178
180 Ga0114129_10002710
181 Ga0114129_10017603
182 Ga0114129_10031948
183 Ga0114129_10045348
184 Ga0105243_10294420
185 Ga0105243_10527115
186 Ga0105249_10006480
187 Ga0105246_10026434
188 Ga0207653_10021939
189 Ga0207643_10045961
190 Ga0207660_10292531
191 Ga0207646_10177208
192 Ga0207670_10028054
193 Ga0207712_10366376
194 Ga0207703_10264954
195 Ga0207674_10124653
196 Ga0209968_1020658
197 Ga0268265_10542060
198 Ga0265323_10012034
199 Ga0265327_10091965
200 Ga0316575_10031182
201 Ga0307405_10325164
202 Ga0307413_10170411
203 Ga0307410_10137835
204 Ga0307409_100136641
205 Ga0307409_100275550
206 Ga0307416_100513203
207 Ga0307414_10342174
208 Ga0307411_10418036
209 Ga0316593_10000039
210 Ga0316593_10001041
211 Ga0316593_10003675
212 Ga0316593_10034114
213 Ga0316593_10069475
214 Ga0316593_10087920
215 Ga0316592_1010837
216 Ga0316592_1032920
217 Ga0316596_1009492
218 Ga0316596_1018606
219 Ga0316596_1056731
220 Ga0316574_0000425
221 Ga0316582_0078504
222 Ga0316582_0082937
223 Ga0316584_0013130
224 Ga0316584_0108178
225 Ga0316581_0006010
226 Ga0451577_0026654
227 Ga0451577_0028491
228 Ga0451577_0032968
229 Ga0451577_0109360
230 Ga0451577_0115417
231 Ga0451577_0185245
232 Ga0451577_0522358
233 Ga0451577_0522374
234 Ga0451577_0609131
235 Ga0453683_0013294
236 Ga0453683_0135690
237 Ga0453683_0170150
238 Ga0453683_0183759
239 Ga0453683_0332325
240 Ga0453683_0387019
241 Ga0453684_0000055
242 Ga0453684_0000588
243 Ga0453684_0010317
244 Ga0453684_0011274
245 Ga0453684_0015585
246 Ga0453684_0025508
247 Ga0453684_0048493
248 Ga0453684_0158746
249 Ga0453684_0175549
250 Ga0453684_0178112
251 Ga0453684_0180919
252 Ga0453684_0188301
253 Ga0453684_0236687
254 Ga0453684_0460106
255 Ga0453684_0752767
256 Ga0453684_0756352
257 Ga0453684_0977155
258 Ga0451576_0078616
259 Ga0451576_0090134
260 Ga0451576_0091748
261 Ga0451576_0112230
262 Ga0451576_0204325
263 Ga0451576_0403861
264 Ga0501031_0375428
265 Ga0501038_0443061
266 Ga0501046_0072358
267 Ga0501073_0109236
268 Ga0501074_0042809
269 Ga0501075_0226322
270 Ga0501076_0016433
271 Ga0501079_0024440
272 Ga0501080_0100617
273 Ga0501081_0157581
274 Ga0501045_0186286
275 Ga0501045_0500321
276 nmdc:mga05p37_292696_c1
277 nmdc:mga05p37_44854_c1
278 nmdc:mga05p37_4654_c1
279 nmdc:mga05p37_5158_c1
280 nmdc:mga05p37_9621_c1
281 nmdc:mga09592_125895_c1
282 nmdc:mga09592_24685_c1
283 nmdc:mga09592_267797_c1
284 nmdc:mga09592_44017_c1
285 nmdc:mga09592_54275_c2
286 nmdc:mga09592_94463_c1
287 nmdc:mga09592_9964_c1
288 nmdc:mga06r32_1022934_c1
289 nmdc:mga06r32_34681_c1
290 nmdc:mga0n895_411493_c1
291 Ga0501084_0028743
292 Ga0501082_0136994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

28

124

0.93

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

163

271

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.9205 1 256
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9177 2 258
8q70-assembly1.cif.gz_A-2 trna pseudouridine synthase a homodimer 0.9174 3 255
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.917 1 256
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9086 2 262
ID Description Score Start End Superfamily
af_Q2FW37_1_104_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9495 3 104 3.30.70.580
1vs3B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9471 1 105 3.30.70.580
1vs3B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9384 1 105 3.30.70.580
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9288 2 105 3.30.70.580
af_Q54FA0_131_252_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9271 2 103 3.30.70.580
ID Description Score Start End GO Terms
AF-A0A1M3KHW2-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9659 1 253 GO:0003723
GO:0031119
GO:0160147
AF-A0A3A4VUF5-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.965 1 256 GO:0003723
GO:0031119
GO:0160147
AF-A0A1M3KHW2-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9621 1 253 GO:0003723
GO:0031119
GO:0160147
AF-A0A399ZFM8-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9608 1 256 GO:0003723
GO:0031119
GO:0160147
AF-A0A3A4VUF5-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9574 1 256 GO:0003723
GO:0031119
GO:0160147

Map