F191815

General Info

Members Datasets Scaffolds Average Seq Length
144 124 288 107

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10363315|Ga0213874_103633151
Length 126
Sequence MDFDVYPTVVQRLKSALKSLPRHDILVSVTRIAKSKMTKERRPGRWLLQDAKARFSELVRRVRSEGPQHVTVHGRDEVVVVAAEEFRRLKGDLTGAALVAAMQASPYRDIEIEPRRSRMHVRDVTL

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
60 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
61 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
62 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
69 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
70 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
71 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
72 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
96 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
97 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
107 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
108 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
117 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
120 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
123 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 2.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.42
Nodule 0
Rhizoplane 9.72
Rhizosphere 67.36
Stem 0
Stem Tuber 0
Unclassified 17.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10363315 3300021377 Unclassified 557
2 LJNas_1035921 3300000546 Bacteria 536
3 rootH2_10124879 3300003320 Unclassified 1678
4 Ga0070670_100069156 3300005331 Bacteria 3031
5 Ga0070666_10012775 3300005335 Bacteria 5309
6 Ga0070680_100537578 3300005336 Bacteria 1001
7 Ga0070667_100640185 3300005367 Unclassified 981
8 Ga0070713_100773948 3300005436 Bacteria 919
9 Ga0070713_101166173 3300005436 Bacteria 745
10 Ga0070681_10028534 3300005458 Bacteria 5611
11 Ga0070685_10786241 3300005466 Bacteria 700
12 Ga0070685_11394827 3300005466 Unclassified 537
13 Ga0070684_100333080 3300005535 Bacteria 1395
14 Ga0068863_100128687 3300005841 Bacteria 2416
15 Ga0070717_10922365 3300006028 Bacteria 795
16 Ga0075365_10102741 3300006038 Bacteria 1959
17 Ga0075362_10065116 3300006177 Bacteria 1654
18 Ga0075370_10080558 3300006353 Bacteria 1871
19 Ga0068871_100749748 3300006358 Bacteria 897
20 Ga0075428_101153469 3300006844 Bacteria 818
21 Ga0075434_100760643 3300006871 Bacteria 986
22 Ga0099795_10096225 3300007788 Bacteria 1155
23 Ga0105240_10025175 3300009093 Bacteria 7826
24 Ga0105240_10102240 3300009093 Bacteria 3483
25 Ga0105245_11515660 3300009098 Unclassified 721
26 Ga0105247_10775017 3300009101 Bacteria 729
27 Ga0114129_10083178 3300009147 Bacteria 4447
28 Ga0114129_10141262 3300009147 Bacteria 3301
29 Ga0105241_10865579 3300009174 Bacteria 837
30 Ga0105248_10652037 3300009177 Bacteria 1188
31 Ga0105237_10355906 3300009545 Bacteria 1468
32 Ga0105237_11126625 3300009545 Bacteria 791
33 Ga0105237_11217000 3300009545 Bacteria 760
34 Ga0105249_13135641 3300009553 Unclassified 531
35 Ga0099796_10026021 3300010159 Unclassified 1854
36 Ga0105246_10756078 3300011119 Bacteria 858
37 Ga0157369_10180456 3300013105 Bacteria 2221
38 Ga0163162_10670963 3300013306 Bacteria 1160
39 Ga0157375_12021396 3300013308 Bacteria 685
40 Ga0163163_10022248 3300014325 Bacteria 5999
41 Ga0163163_10181034 3300014325 Bacteria 2155
42 Ga0157379_10419685 3300014968 Bacteria 1232
43 Ga0213874_10131617 3300021377 Bacteria 859
44 Ga0207680_10064144 3300025903 Bacteria 2251
45 Ga0207707_10058721 3300025912 Bacteria 3347
46 Ga0207695_10175918 3300025913 Bacteria 2063
47 Ga0207695_11063787 3300025913 Bacteria 689
48 Ga0207671_10099043 3300025914 Bacteria 2206
49 Ga0207671_10122713 3300025914 Bacteria 1987
50 Ga0207671_10126683 3300025914 Bacteria 1957
51 Ga0207671_10934808 3300025914 Unclassified 685
52 Ga0207694_10425643 3300025924 Bacteria 1106
53 Ga0207694_10542299 3300025924 Bacteria 976
54 Ga0207650_10071210 3300025925 Bacteria 2615
55 Ga0207700_10868000 3300025928 Bacteria 807
56 Ga0207711_10600414 3300025941 Bacteria 1027
57 Ga0207703_11164942 3300026035 Bacteria 741
58 Ga0207641_10112184 3300026088 Bacteria 2419
59 Ga0209179_1011945 3300027512 Bacteria 1550
60 Ga0268266_10000271 3300028379 Bacteria 85685
61 Ga0268266_12123311 3300028379 Unclassified 534
62 Ga0265318_10016540 3300028577 Bacteria 3048
63 Ga0307515_10213766 3300028794 Bacteria 1765
64 Ga0307515_10368790 3300028794 Bacteria 1073
65 Ga0265338_10289303 3300028800 Bacteria 1194
66 Ga0265770_1052083 3300030878 Bacteria 743
67 Ga0265760_10011146 3300031090 Bacteria 2569
68 Ga0265760_10110014 3300031090 Unclassified 877
69 Ga0265340_10027984 3300031247 Bacteria 2838
70 Ga0265339_10085802 3300031249 Bacteria 1657
71 Ga0307513_10003220 3300031456 Bacteria 22271
72 Ga0307509_10687761 3300031507 Unclassified 690
73 Ga0307508_10000152 3300031616 Bacteria 82883
74 Ga0373923_0290182 3300035111 Unclassified 772
75 Ga0373943_0303451 3300035170 Bacteria 907
76 Ga0373946_0214929 3300035171 Bacteria 926
77 Ga0373931_1242975 3300035691 Bacteria 511
78 Ga0373933_0000018 3300035724 Bacteria 98044
79 Ga0373947_0086325 3300035725 Bacteria 1950
80 Ga0373925_0223115 3300037068 Bacteria 1505
81 Ga0436363_0975328 3300039450 Bacteria 1150
82 Ga0436363_1351842 3300039450 Unclassified 1539
83 Ga0439465_0138039 3300041413 Bacteria 864
84 Ga0495629_0277060 3300046459 Bacteria 1152
85 Ga0495650_0011674 3300046471 Bacteria 4787
86 Ga0495580_0511202 3300046472 Bacteria 801
87 Ga0495662_0136550 3300046476 Bacteria 1206
88 Ga0495664_0315703 3300046477 Bacteria 943
89 Ga0495618_0897254 3300046514 Bacteria 512
90 Ga0495628_1088895 3300046516 Unclassified 546
91 Ga0495648_0128438 3300046524 Bacteria 1351
92 Ga0495640_0172065 3300046533 Bacteria 1383
93 Ga0495645_0172903 3300046543 Bacteria 1486
94 Ga0495658_0374054 3300046683 Bacteria 907
95 Ga0495674_0101824 3300047319 Unclassified 2443
96 Ga0495674_0418857 3300047319 Bacteria 1079
97 Ga0495672_0394212 3300047320 Unclassified 634
98 Ga0495680_0592420 3300047322 Bacteria 743
99 Ga0495687_079098 3300047443 Bacteria 1293
100 Ga0496100_0437785 3300048903 Bacteria 1001
101 Ga0496101_0021125 3300048904 Bacteria 4469
102 Ga0496102_0268050 3300048905 Bacteria 1610
103 Ga0496103_0320189 3300048906 Bacteria 997
104 Ga0496104_0140130 3300048907 Bacteria 2323
105 Ga0496105_0089840 3300048908 Bacteria 2538
106 Ga0496106_1533799 3300048909 Bacteria 512
107 Ga0496108_0064093 3300048911 Bacteria 3095
108 Ga0496109_0097264 3300048912 Bacteria 2728
109 Ga0496110_0116226 3300048913 Bacteria 2408
110 Ga0496111_0158099 3300048914 Bacteria 1682
111 Ga0496113_0098503 3300048916 Bacteria 2263
112 Ga0496115_0466894 3300048918 Bacteria 1018
113 Ga0496115_1334096 3300048918 Unclassified 533
114 Ga0496119_0013070 3300048922 Bacteria 6658
115 Ga0496120_0003946 3300048923 Bacteria 12916
116 Ga0496121_0040307 3300048924 Bacteria 4100
117 Ga0496122_0027983 3300048925 Bacteria 4801
118 Ga0496123_0154600 3300048926 Bacteria 1232
119 Ga0496125_0002701 3300048928 Bacteria 22584
120 Ga0496126_0002018 3300048929 Bacteria 28703
121 Ga0496126_0033550 3300048929 Bacteria 4828
122 Ga0495678_127877 3300049459 Bacteria 845
123 Ga0501072_1400772 3300049588 Unclassified 541
124 Ga0501073_1072535 3300049589 Unclassified 554
125 Ga0501075_1541039 3300049591 Unclassified 503
126 Ga0501081_0285789 3300049743 Bacteria 1208
127 nmdc:mga03683_354891_c1 3300050489 Unclassified 694
128 nmdc:mga0k408_223013_c1 3300050493 Bacteria 1125
129 nmdc:mga07m45_184651_c1 3300050496 Bacteria 1212
130 nmdc:mga05p37_347923_c1 3300050507 Bacteria 1746
131 nmdc:mga09592_127776_c1 3300050508 Bacteria 2185
132 nmdc:mga06r32_114260_c1 3300050510 Bacteria 2658
133 nmdc:mga08y16_307015_c1 3300050511 Bacteria 1634
134 nmdc:mga0sz30_125225_c1 3300050516 Bacteria 1130
135 Ga0495601_0163019 3300053077 Bacteria 1457
136 Ga0500583_0595376 3300053092 Unclassified 509
137 Ga0500572_001893 3300053111 Bacteria 5272
138 Ga0500559_0000491 3300053136 Bacteria 27718
139 Ga0500568_0120466 3300053139 Unclassified 978
140 Ga0500604_0107862 3300053151 Unclassified 923
141 Ga0500616_0043358 3300053153 Bacteria 2404
142 Ga0500576_028734 3300053725 Plasmid 2534
143 Ga0500645_013171 3300053730 Bacteria 2660
144 Ga0501084_1493750 3300054114 Unclassified 565
145 Ga0213874_10363315
146 LJNas_1035921
147 rootH2_10124879
148 Ga0070670_100069156
149 Ga0070666_10012775
150 Ga0070680_100537578
151 Ga0070667_100640185
152 Ga0070713_100773948
153 Ga0070713_101166173
154 Ga0070681_10028534
155 Ga0070685_10786241
156 Ga0070685_11394827
157 Ga0070684_100333080
158 Ga0068863_100128687
159 Ga0070717_10922365
160 Ga0075365_10102741
161 Ga0075362_10065116
162 Ga0075370_10080558
163 Ga0068871_100749748
164 Ga0075428_101153469
165 Ga0075434_100760643
166 Ga0099795_10096225
167 Ga0105240_10025175
168 Ga0105240_10102240
169 Ga0105245_11515660
170 Ga0105247_10775017
171 Ga0114129_10083178
172 Ga0114129_10141262
173 Ga0105241_10865579
174 Ga0105248_10652037
175 Ga0105237_10355906
176 Ga0105237_11126625
177 Ga0105237_11217000
178 Ga0105249_13135641
179 Ga0099796_10026021
180 Ga0105246_10756078
181 Ga0157369_10180456
182 Ga0163162_10670963
183 Ga0157375_12021396
184 Ga0163163_10022248
185 Ga0163163_10181034
186 Ga0157379_10419685
187 Ga0213874_10131617
188 Ga0207680_10064144
189 Ga0207707_10058721
190 Ga0207695_10175918
191 Ga0207695_11063787
192 Ga0207671_10099043
193 Ga0207671_10122713
194 Ga0207671_10126683
195 Ga0207671_10934808
196 Ga0207694_10425643
197 Ga0207694_10542299
198 Ga0207650_10071210
199 Ga0207700_10868000
200 Ga0207711_10600414
201 Ga0207703_11164942
202 Ga0207641_10112184
203 Ga0209179_1011945
204 Ga0268266_10000271
205 Ga0268266_12123311
206 Ga0265318_10016540
207 Ga0307515_10213766
208 Ga0307515_10368790
209 Ga0265338_10289303
210 Ga0265770_1052083
211 Ga0265760_10011146
212 Ga0265760_10110014
213 Ga0265340_10027984
214 Ga0265339_10085802
215 Ga0307513_10003220
216 Ga0307509_10687761
217 Ga0307508_10000152
218 Ga0373923_0290182
219 Ga0373943_0303451
220 Ga0373946_0214929
221 Ga0373931_1242975
222 Ga0373933_0000018
223 Ga0373947_0086325
224 Ga0373925_0223115
225 Ga0436363_0975328
226 Ga0436363_1351842
227 Ga0439465_0138039
228 Ga0495629_0277060
229 Ga0495650_0011674
230 Ga0495580_0511202
231 Ga0495662_0136550
232 Ga0495664_0315703
233 Ga0495618_0897254
234 Ga0495628_1088895
235 Ga0495648_0128438
236 Ga0495640_0172065
237 Ga0495645_0172903
238 Ga0495658_0374054
239 Ga0495674_0101824
240 Ga0495674_0418857
241 Ga0495672_0394212
242 Ga0495680_0592420
243 Ga0495687_079098
244 Ga0496100_0437785
245 Ga0496101_0021125
246 Ga0496102_0268050
247 Ga0496103_0320189
248 Ga0496104_0140130
249 Ga0496105_0089840
250 Ga0496106_1533799
251 Ga0496108_0064093
252 Ga0496109_0097264
253 Ga0496110_0116226
254 Ga0496111_0158099
255 Ga0496113_0098503
256 Ga0496115_0466894
257 Ga0496115_1334096
258 Ga0496119_0013070
259 Ga0496120_0003946
260 Ga0496121_0040307
261 Ga0496122_0027983
262 Ga0496123_0154600
263 Ga0496125_0002701
264 Ga0496126_0002018
265 Ga0496126_0033550
266 Ga0495678_127877
267 Ga0501072_1400772
268 Ga0501073_1072535
269 Ga0501075_1541039
270 Ga0501081_0285789
271 nmdc:mga03683_354891_c1
272 nmdc:mga0k408_223013_c1
273 nmdc:mga07m45_184651_c1
274 nmdc:mga05p37_347923_c1
275 nmdc:mga09592_127776_c1
276 nmdc:mga06r32_114260_c1
277 nmdc:mga08y16_307015_c1
278 nmdc:mga0sz30_125225_c1
279 Ga0495601_0163019
280 Ga0500583_0595376
281 Ga0500572_001893
282 Ga0500559_0000491
283 Ga0500568_0120466
284 Ga0500604_0107862
285 Ga0500616_0043358
286 Ga0500576_028734
287 Ga0500645_013171
288 Ga0501084_1493750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02604

PhdYeFM_antitox

Antitoxin Phd_YefM, type II toxin-antitoxin system

45

113

0.88

Map