F190255

General Info

Members Datasets Scaffolds Average Seq Length
143 115 286 286

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935409751|2935410936
Length 317
Sequence GWSGVGGRWQHGVVPELPEVEALAAFLRERAVGRTITSAAVTAISALKTFDPPLSALAGGAIAAVDRHGKFVDLTVGRDPGAEVVDPGDAVGAGPPVHLVFHLARAGWLRWFDEVPKTILKPGKGPIALRLKLDDGSGFDLTEAGTKKSLAVSVVRDPNAVPGIARLGPDPTAPGFTLADFQAVLDGRRTQIKGVLRDQSVFAGIGNAYSDEILHAARMSPYALAAKLSPEQVLTLFAALRDTLAEAIATASGRPPADLKDAKRRGMQVHGRTGEACPVCGDTVREVRFADSSFQYCPTCQTGGRPLADRVLSRLLK

Samples

Sample ID Description Type Environment
1 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
10 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
19 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
20 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
29 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
30 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
31 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
32 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
33 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
34 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
37 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
40 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
48 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
53 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
54 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
55 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
56 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
57 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
58 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
59 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
60 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
61 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
62 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
63 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
64 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
65 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
66 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
67 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
68 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
69 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
70 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
71 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
72 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
73 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
83 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
95 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
96 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
97 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
98 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
99 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
100 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
101 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
102 2643221576 Nocardioides sp. Root614 Isolate Unclassified
103 2643221590 Nocardioides sp. Root682 Isolate Unclassified
104 2643221617 Nocardioides sp. Root79 Isolate Unclassified
105 2643221620 Nocardioides sp. Root240 Isolate Unclassified
106 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
107 2738541305 Nocardioides sp. CF167 Isolate Unclassified
108 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
109 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
110 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
111 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
112 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
113 2902582711 Micromonospora sp. AP08 Isolate Unclassified
114 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
115 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.11
Metatranscriptomes 1.4
Isolates 10.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.99
Nodule 0
Rhizoplane 11.89
Rhizosphere 64.34
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1008439 3300003578 Bacteria 3050
2 Ga0006562J51391_1008440 3300003578 Bacteria 2290
3 Ga0070658_10089746 3300005327 Bacteria 2531
4 Ga0070682_100176536 3300005337 Bacteria 1489
5 Ga0068868_100106485 3300005338 Bacteria 2274
6 Ga0070671_100029277 3300005355 Bacteria 4540
7 Ga0070711_100021912 3300005439 Bacteria 4135
8 Ga0070663_100488306 3300005455 Bacteria 1021
9 Ga0075365_10006400 3300006038 Bacteria 6479
10 Ga0075365_10010509 3300006038 Bacteria 5392
11 Ga0070712_100165038 3300006175 Bacteria 1713
12 Ga0075362_10112014 3300006177 Bacteria 1285
13 Ga0075367_10106006 3300006178 Bacteria 1722
14 Ga0075428_100004871 3300006844 Bacteria 14898
15 Ga0075431_100144003 3300006847 Bacteria 2456
16 Ga0075429_100167582 3300006880 Bacteria 1924
17 Ga0105245_10263389 3300009098 Bacteria 1678
18 Ga0114129_10008019 3300009147 Bacteria 15039
19 Ga0114129_10370819 3300009147 Bacteria 1892
20 Ga0157372_10739815 3300013307 Bacteria 1144
21 Ga0157377_10003029 3300014745 Bacteria 7532
22 Ga0163161_10443271 3300017792 Bacteria 1048
23 Ga0207688_10091079 3300025901 Bacteria 1751
24 Ga0207705_10115603 3300025909 Bacteria 1985
25 Ga0207693_10011710 3300025915 Bacteria 7094
26 Ga0207665_10108141 3300025939 Bacteria 1951
27 Ga0207678_10101525 3300026067 Bacteria 2456
28 Ga0207675_100135401 3300026118 Bacteria 2337
29 Ga0207675_100577339 3300026118 Bacteria 1125
30 Ga0207698_10243666 3300026142 Bacteria 1640
31 Ga0307508_10325096 3300031616 Bacteria 1130
32 Ga0307405_10241115 3300031731 Bacteria 1339
33 Ga0307413_10446752 3300031824 Bacteria 1025
34 Ga0307518_10134770 3300031838 Bacteria 1731
35 Ga0307410_10000443 3300031852 Bacteria 16622
36 Ga0307406_10015464 3300031901 Bacteria 4417
37 Ga0307407_10009694 3300031903 Bacteria 4499
38 Ga0307409_100016047 3300031995 Bacteria 4940
39 Ga0307416_100005301 3300032002 Bacteria 7903
40 Ga0307416_100086875 3300032002 Bacteria 2668
41 Ga0307414_10029181 3300032004 Bacteria 3587
42 Ga0307411_10153995 3300032005 Bacteria 1712
43 Ga0307415_100028912 3300032126 Bacteria 3534
44 Ga0373937_0577370 3300036401 Bacteria 1068
45 Ga0395900_0017003 3300037418 Bacteria 7424
46 Ga0395900_0120592 3300037418 Bacteria 2691
47 Ga0395900_0194205 3300037418 Bacteria 2057
48 Ga0395898_0169999 3300037466 Bacteria 2084
49 Ga0395898_0186567 3300037466 Bacteria 1982
50 Ga0436364_0918908 3300037853 Bacteria 4863
51 Ga0395901_0215731 3300038443 Bacteria 2007
52 Ga0395901_0262261 3300038443 Bacteria 1798
53 Ga0436365_0986987 3300039437 Bacteria 8602
54 Ga0466965_0032352 3300044683 Bacteria 2554
55 Ga0466971_0016309 3300044719 Unclassified 3276
56 Ga0466971_0048361 3300044719 Bacteria 1912
57 Ga0466970_0012170 3300044765 Bacteria 4393
58 Ga0466960_0002311 3300044901 Bacteria 7153
59 Ga0466960_0003632 3300044901 Bacteria 5954
60 Ga0466960_0046507 3300044901 Bacteria 2078
61 Ga0466959_0020273 3300045049 Bacteria 4896
62 Ga0466959_0054682 3300045049 Bacteria 2916
63 Ga0466959_0151942 3300045049 Bacteria 1632
64 Ga0466958_0024259 3300045836 Bacteria 3568
65 Ga0466958_0161539 3300045836 Bacteria 1415
66 Ga0466967_0124622 3300045976 Bacteria 2385
67 Ga0495590_0012351 3300046457 Bacteria 3169
68 Ga0495629_0353604 3300046459 Bacteria 1002
69 Ga0495658_0194950 3300046683 Bacteria 1261
70 Ga0495672_0007030 3300047320 Bacteria 8545
71 Ga0495686_0214415 3300047472 Bacteria 1098
72 Ga0496100_0124831 3300048903 Bacteria 1805
73 Ga0496101_0008303 3300048904 Bacteria 6785
74 Ga0496102_0005005 3300048905 Bacteria 11227
75 Ga0496103_0092842 3300048906 Bacteria 1905
76 Ga0496105_0519491 3300048908 Bacteria 933
77 Ga0496106_0013660 3300048909 Bacteria 5995
78 Ga0496106_0025046 3300048909 Bacteria 4438
79 Ga0496107_0000838 3300048910 Bacteria 17983
80 Ga0496107_0057987 3300048910 Bacteria 2799
81 Ga0496108_0189678 3300048911 Bacteria 1781
82 Ga0496109_0088131 3300048912 Bacteria 2868
83 Ga0496110_0150427 3300048913 Bacteria 2108
84 Ga0496111_0042369 3300048914 Bacteria 3269
85 Ga0496112_0129544 3300048915 Bacteria 2494
86 Ga0496114_0042062 3300048917 Bacteria 3787
87 Ga0496115_0003986 3300048918 Bacteria 10650
88 Ga0496115_0079167 3300048918 Bacteria 2675
89 Ga0496117_0001060 3300048920 Bacteria 41966
90 Ga0496118_0150037 3300048921 Bacteria 1461
91 Ga0496123_0030780 3300048926 Bacteria 3921
92 Ga0496123_0157791 3300048926 Bacteria 1214
93 Ga0496125_0334825 3300048928 Bacteria 911
94 Ga0501034_0027648 3300049571 Bacteria 5768
95 Ga0501034_0398983 3300049571 Bacteria 1298
96 Ga0501037_0068414 3300049573 Bacteria 2585
97 Ga0501038_0026417 3300049574 Bacteria 5172
98 Ga0501038_0092662 3300049574 Bacteria 2529
99 Ga0501039_0258817 3300049575 Bacteria 1368
100 Ga0501040_0058457 3300049576 Bacteria 2648
101 Ga0501042_0042659 3300049578 Bacteria 3230
102 Ga0501046_0090933 3300049580 Bacteria 2348
103 Ga0501046_0101171 3300049580 Bacteria 2211
104 Ga0501067_0011330 3300049583 Bacteria 4938
105 Ga0501067_0014716 3300049583 Bacteria 4328
106 Ga0501069_0072084 3300049585 Bacteria 1936
107 Ga0501071_0170846 3300049587 Bacteria 1627
108 Ga0501072_0201324 3300049588 Bacteria 1588
109 Ga0501073_0058715 3300049589 Bacteria 2688
110 Ga0501075_0193726 3300049591 Bacteria 1550
111 Ga0501077_0100055 3300049593 Bacteria 1837
112 Ga0501077_0220881 3300049593 Bacteria 1204
113 Ga0501044_0011981 3300049823 Bacteria 9396
114 nmdc:mga0yw44_1128_c1 3300050492 Bacteria 10325
115 nmdc:mga05p37_381913_c1 3300050507 Bacteria 1650
116 nmdc:mga05p37_4519_c1 3300050507 Bacteria 16264
117 nmdc:mga09592_159666_c1 3300050508 Bacteria 1947
118 nmdc:mga09592_277675_c1 3300050508 Bacteria 1453
119 nmdc:mga08y16_656556_c1 3300050511 Bacteria 1052
120 Ga0500556_0003039 3300053104 Bacteria 5038
121 Ga0500593_000619 3300053117 Bacteria 13670
122 Ga0500568_0000098 3300053139 Bacteria 80393
123 Ga0500573_0036670 3300053140 Bacteria 2831
124 Ga0500616_0000113 3300053153 Bacteria 150722
125 Ga0501084_0096328 3300054114 Bacteria 2485
126 Ga0466962_0038497 3300061719 Bacteria 2290
127 Ga0466962_0043365 3300061719 Bacteria 2153
128 Ga0466962_0146476 3300061719 Bacteria 1145
129 2935410936 2935409751 Bacteria 4179611
130 2643890877 2643221576 Bacteria 5214352
131 2643959933 2643221590 Bacteria 5214697
132 2644100923 2643221617 Bacteria 5139111
133 2644117331 2643221620 Bacteria 5134593
134 2723641518 2721755702 Bacteria 4373124
135 2738869079 2738541305 Bacteria 4910150
136 2812330559 2811994874 Bacteria 5367947
137 2857485765 2857481737 Bacteria 4761446
138 2867307978 2867302475 Bacteria 7087181
139 2867318631 2867312974 Bacteria 7058875
140 2867324055 2867319477 Bacteria 7069771
141 2902588424 2902582711 Bacteria 6187705
142 2995464767 2995463766 Bacteria 8577691
143 3001890076 3001889506 Bacteria 2975194
144 Ga0006562J51391_1008439
145 Ga0006562J51391_1008440
146 Ga0070658_10089746
147 Ga0070682_100176536
148 Ga0068868_100106485
149 Ga0070671_100029277
150 Ga0070711_100021912
151 Ga0070663_100488306
152 Ga0075365_10006400
153 Ga0075365_10010509
154 Ga0070712_100165038
155 Ga0075362_10112014
156 Ga0075367_10106006
157 Ga0075428_100004871
158 Ga0075431_100144003
159 Ga0075429_100167582
160 Ga0105245_10263389
161 Ga0114129_10008019
162 Ga0114129_10370819
163 Ga0157372_10739815
164 Ga0157377_10003029
165 Ga0163161_10443271
166 Ga0207688_10091079
167 Ga0207705_10115603
168 Ga0207693_10011710
169 Ga0207665_10108141
170 Ga0207678_10101525
171 Ga0207675_100135401
172 Ga0207675_100577339
173 Ga0207698_10243666
174 Ga0307508_10325096
175 Ga0307405_10241115
176 Ga0307413_10446752
177 Ga0307518_10134770
178 Ga0307410_10000443
179 Ga0307406_10015464
180 Ga0307407_10009694
181 Ga0307409_100016047
182 Ga0307416_100005301
183 Ga0307416_100086875
184 Ga0307414_10029181
185 Ga0307411_10153995
186 Ga0307415_100028912
187 Ga0373937_0577370
188 Ga0395900_0017003
189 Ga0395900_0120592
190 Ga0395900_0194205
191 Ga0395898_0169999
192 Ga0395898_0186567
193 Ga0436364_0918908
194 Ga0395901_0215731
195 Ga0395901_0262261
196 Ga0436365_0986987
197 Ga0466965_0032352
198 Ga0466971_0016309
199 Ga0466971_0048361
200 Ga0466970_0012170
201 Ga0466960_0002311
202 Ga0466960_0003632
203 Ga0466960_0046507
204 Ga0466959_0020273
205 Ga0466959_0054682
206 Ga0466959_0151942
207 Ga0466958_0024259
208 Ga0466958_0161539
209 Ga0466967_0124622
210 Ga0495590_0012351
211 Ga0495629_0353604
212 Ga0495658_0194950
213 Ga0495672_0007030
214 Ga0495686_0214415
215 Ga0496100_0124831
216 Ga0496101_0008303
217 Ga0496102_0005005
218 Ga0496103_0092842
219 Ga0496105_0519491
220 Ga0496106_0013660
221 Ga0496106_0025046
222 Ga0496107_0000838
223 Ga0496107_0057987
224 Ga0496108_0189678
225 Ga0496109_0088131
226 Ga0496110_0150427
227 Ga0496111_0042369
228 Ga0496112_0129544
229 Ga0496114_0042062
230 Ga0496115_0003986
231 Ga0496115_0079167
232 Ga0496117_0001060
233 Ga0496118_0150037
234 Ga0496123_0030780
235 Ga0496123_0157791
236 Ga0496125_0334825
237 Ga0501034_0027648
238 Ga0501034_0398983
239 Ga0501037_0068414
240 Ga0501038_0026417
241 Ga0501038_0092662
242 Ga0501039_0258817
243 Ga0501040_0058457
244 Ga0501042_0042659
245 Ga0501046_0090933
246 Ga0501046_0101171
247 Ga0501067_0011330
248 Ga0501067_0014716
249 Ga0501069_0072084
250 Ga0501071_0170846
251 Ga0501072_0201324
252 Ga0501073_0058715
253 Ga0501075_0193726
254 Ga0501077_0100055
255 Ga0501077_0220881
256 Ga0501044_0011981
257 nmdc:mga0yw44_1128_c1
258 nmdc:mga05p37_381913_c1
259 nmdc:mga05p37_4519_c1
260 nmdc:mga09592_159666_c1
261 nmdc:mga09592_277675_c1
262 nmdc:mga08y16_656556_c1
263 Ga0500556_0003039
264 Ga0500593_000619
265 Ga0500568_0000098
266 Ga0500573_0036670
267 Ga0500616_0000113
268 Ga0501084_0096328
269 Ga0466962_0038497
270 Ga0466962_0043365
271 Ga0466962_0146476
272 2935410936
273 2643890877
274 2643959933
275 2644100923
276 2644117331
277 2723641518
278 2738869079
279 2812330559
280 2857485765
281 2867307978
282 2867318631
283 2867324055
284 2902588424
285 2995464767
286 3001890076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

167

255

0.97

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

274

303

0.96

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

14

148

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kfv-assembly2.cif.gz_B crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.8901 3 277
1kfv-assembly1.cif.gz_A crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.8879 3 277
4v5z-assembly1.cif.gz_Am structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.8826 162 213
1l2b-assembly1.cif.gz_A mutm (fpg) dna end-product structure 0.8814 2 276
1kfv-assembly2.cif.gz_B crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.8804 3 277
ID Description Score Start End Superfamily
af_L0T864_10_149_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9725 141 283 1.10.8.50
af_L0T864_10_149_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9658 141 283 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9347 141 276 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9199 141 276 1.10.8.50
1kfvB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9115 143 272 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A3D0ZEA3-F1-model_v4 Endonuclease VIII 0.9711 127 292 GO:0003684
GO:0003906
GO:0004519
GO:0006284
GO:0008270
GO:0034039
AF-A0A850CJ66-F1-model_v4 Fpg/Nei family DNA glycosylase 0.967 1 231 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039
AF-A0A7X7NJS0-F1-model_v4 Fpg/Nei family DNA glycosylase 0.9646 1 259 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039
AF-A0A7X7NJS0-F1-model_v4 Fpg/Nei family DNA glycosylase 0.9609 1 259 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039
AF-A0A3D0ZEA3-F1-model_v4 Endonuclease VIII 0.9597 127 292 GO:0003684
GO:0003906
GO:0004519
GO:0006284
GO:0008270
GO:0034039

Map