F181921

General Info

Members Datasets Scaffolds Average Seq Length
141 120 282 214

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10000555|Ga0070685_100005556
Length 234
Sequence MFIGHAAVALIGKRGAPRTSLGVLLAAATFLDLLWPVFLLTGWERVRIDPGNTAVTPLDFVSYPLSHSLLAVLGWSLAAAVVYYVVTQYGYGAWTVGLLVLSHWVLDWLTHRPDLPLWPGGPRTGMGMWHSVPATVIVELLLFAVGLAVYVGTTRSRDAIGRWAFWGLMAFYLAVYAANLFGPPPPHERAIAWAGLLMWLFPLWAWWADAHREVTPQLPETAYGSVQRAPSTEP

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
76 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
77 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
119 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
120 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.55
Rhizosphere 92.91
Stem 0
Stem Tuber 0
Unclassified 21.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10000555 3300005466 Bacteria 20900
2 Ga0065707_10360455 3300005295 Unclassified 902
3 Ga0070658_10000010 3300005327 Bacteria 297212
4 Ga0070683_100001679 3300005329 Bacteria 17191
5 Ga0070680_100778442 3300005336 Bacteria 824
6 Ga0070687_100228764 3300005343 Bacteria 1143
7 Ga0070675_100000020 3300005354 Bacteria 168778
8 Ga0070659_100055193 3300005366 Bacteria 3130
9 Ga0070701_10008957 3300005438 Bacteria 4360
10 Ga0070694_100111441 3300005444 Bacteria 1950
11 Ga0070662_100003270 3300005457 Bacteria 10082
12 Ga0070685_10018720 3300005466 Bacteria 3728
13 Ga0070698_100010391 3300005471 Bacteria 9941
14 Ga0070698_100035271 3300005471 Bacteria 5173
15 Ga0070686_100000017 3300005544 Bacteria 151908
16 Ga0070695_100034018 3300005545 Bacteria 3192
17 Ga0070704_100092938 3300005549 Bacteria 2253
18 Ga0070704_100859594 3300005549 Bacteria 814
19 Ga0070664_100129239 3300005564 Bacteria 2218
20 Ga0068852_100239818 3300005616 Unclassified 1732
21 Ga0068859_100080771 3300005617 Unclassified 3293
22 Ga0068870_10152546 3300005840 Unclassified 1362
23 Ga0068863_100089676 3300005841 Bacteria 2916
24 Ga0068858_100113559 3300005842 Bacteria 2530
25 Ga0068860_100022532 3300005843 Bacteria 6091
26 Ga0068871_100239376 3300006358 Unclassified 1577
27 Ga0075428_100191359 3300006844 Bacteria 2212
28 Ga0075430_100013221 3300006846 Bacteria 7033
29 Ga0075430_100294355 3300006846 Bacteria 1343
30 Ga0075431_100001877 3300006847 Bacteria 19911
31 Ga0075431_100080455 3300006847 Unclassified 3364
32 Ga0075431_100242170 3300006847 Bacteria 1834
33 Ga0075429_100000233 3300006880 Bacteria 38047
34 Ga0075429_100113097 3300006880 Bacteria 2373
35 Ga0068865_100580199 3300006881 Bacteria 945
36 Ga0097620_100080767 3300006931 Unclassified 3293
37 Ga0105244_10013172 3300009036 Bacteria 4844
38 Ga0111539_10069758 3300009094 Bacteria 4150
39 Ga0114129_10134160 3300009147 Bacteria 3398
40 Ga0105243_10036330 3300009148 Bacteria 3824
41 Ga0105242_10033427 3300009176 Bacteria 4117
42 Ga0105237_11139328 3300009545 Unclassified 787
43 Ga0105238_10000069 3300009551 Bacteria 117591
44 Ga0157370_10041669 3300013104 Bacteria 4428
45 Ga0157378_10374486 3300013297 Unclassified 1397
46 Ga0213876_10017230 3300021384 Bacteria 3814
47 Ga0207655_1034018 3300025728 Bacteria 2297
48 Ga0207643_10153033 3300025908 Unclassified 1384
49 Ga0207705_10000016 3300025909 Bacteria 377359
50 Ga0207694_10000038 3300025924 Bacteria 186790
51 Ga0207659_10000035 3300025926 Bacteria 104092
52 Ga0207706_10005213 3300025933 Bacteria 12131
53 Ga0207686_10005495 3300025934 Bacteria 6801
54 Ga0207670_10614069 3300025936 Bacteria 894
55 Ga0207679_10088184 3300025945 Bacteria 2391
56 Ga0207667_10097716 3300025949 Bacteria 3030
57 Ga0207703_10108232 3300026035 Bacteria 2367
58 Ga0207702_10154867 3300026078 Bacteria 2088
59 Ga0268264_10043280 3300028381 Bacteria 3731
60 Ga0265319_1003471 3300028563 Bacteria 8202
61 Ga0265318_10000717 3300028577 Bacteria 22246
62 Ga0307511_10032065 3300030521 Bacteria 4678
63 Ga0265330_10001927 3300031235 Bacteria 11535
64 Ga0265332_10000766 3300031238 Bacteria 19746
65 Ga0265320_10001527 3300031240 Bacteria 16789
66 Ga0265325_10053222 3300031241 Unclassified 2076
67 Ga0265329_10003762 3300031242 Bacteria 6521
68 Ga0265340_10004041 3300031247 Bacteria 8241
69 Ga0265339_10015559 3300031249 Unclassified 4557
70 Ga0265331_10001913 3300031250 Bacteria 14587
71 Ga0265316_10001666 3300031344 Bacteria 23646
72 Ga0265313_10000314 3300031595 Bacteria 52784
73 Ga0307508_10094102 3300031616 Bacteria 2587
74 Ga0265314_10004927 3300031711 Bacteria 12194
75 Ga0265342_10001765 3300031712 Bacteria 19738
76 Ga0316576_10082074 3300031727 Bacteria 2393
77 Ga0316576_10379161 3300031727 Bacteria 1050
78 Ga0307406_10511357 3300031901 Unclassified 976
79 Ga0307412_10204927 3300031911 Unclassified 1501
80 Ga0307409_100161132 3300031995 Bacteria 1962
81 Ga0307416_100056325 3300032002 Unclassified 3172
82 Ga0307411_10215441 3300032005 Bacteria 1486
83 Ga0307507_10118495 3300033179 Bacteria 2128
84 Ga0373959_0000183 3300034820 Bacteria 13940
85 Ga0373932_0118778 3300035112 Bacteria 880
86 Ga0373936_0054084 3300035113 Bacteria 1628
87 Ga0373961_0094626 3300035241 Unclassified 959
88 Ga0373931_0364975 3300035691 Unclassified 907
89 Ga0373937_0687392 3300036401 Bacteria 969
90 Ga0316584_0449344 3300036712 Bacteria 912
91 Ga0395899_0032281 3300037312 Bacteria 3933
92 Ga0395905_0174945 3300037471 Unclassified 2015
93 Ga0395901_0092796 3300038443 Bacteria 3160
94 Ga0436365_1411604 3300039437 Bacteria 5391
95 Ga0439441_021149 3300042001 Unclassified 1198
96 Ga0451577_0139787 3300042876 Unclassified 2175
97 Ga0466961_0187712 3300044693 Bacteria 1282
98 Ga0453684_0027148 3300044712 Bacteria 8226
99 Ga0453684_0034723 3300044712 Bacteria 6989
100 Ga0453684_0035588 3300044712 Bacteria 6879
101 Ga0453684_0091208 3300044712 Bacteria 3762
102 Ga0453684_0647573 3300044712 Bacteria 1153
103 Ga0451576_0335223 3300045051 Unclassified 1583
104 Ga0495664_0002420 3300046477 Bacteria 10032
105 Ga0495630_0095252 3300046517 Bacteria 2251
106 Ga0495586_0018174 3300046535 Bacteria 3741
107 Ga0495621_0037600 3300046539 Unclassified 1684
108 Ga0495634_0001254 3300046642 Bacteria 23321
109 Ga0495649_0374141 3300046694 Unclassified 717
110 Ga0496100_0975012 3300048903 Unclassified 667
111 Ga0496101_0071250 3300048904 Bacteria 2548
112 Ga0496111_0301934 3300048914 Bacteria 1187
113 Ga0496112_0341160 3300048915 Unclassified 1441
114 Ga0496113_0651731 3300048916 Unclassified 842
115 Ga0501034_0065216 3300049571 Unclassified 3654
116 Ga0501034_0120124 3300049571 Bacteria 2614
117 Ga0501040_0436429 3300049576 Bacteria 942
118 Ga0501041_0043829 3300049577 Bacteria 2720
119 Ga0501073_0199083 3300049589 Unclassified 1385
120 Ga0501075_0267620 3300049591 Bacteria 1302
121 Ga0501075_0289153 3300049591 Bacteria 1249
122 Ga0501075_0487407 3300049591 Unclassified 940
123 Ga0501076_0086000 3300049592 Bacteria 2527
124 Ga0501202_049095 3300049652 Bacteria 931
125 Ga0501080_0100013 3300049742 Bacteria 2691
126 Ga0501081_0216751 3300049743 Bacteria 1391
127 Ga0501081_0285024 3300049743 Bacteria 1210
128 nmdc:mga09592_283010_c1 3300050508 Bacteria 1438
129 nmdc:mga09592_436913_c1 3300050508 Unclassified 1130
130 nmdc:mga09592_7143_c1 3300050508 Bacteria 9077
131 nmdc:mga0qj67_155434_c1 3300050509 Bacteria 1856
132 nmdc:mga0qj67_4313_c1 3300050509 Bacteria 10308
133 nmdc:mga06r32_12110_c1 3300050510 Bacteria 7778
134 nmdc:mga06r32_1289535_c1 3300050510 Bacteria 675
135 nmdc:mga06r32_164388_c1 3300050510 Bacteria 2202
136 nmdc:mga08y16_58464_c1 3300050511 Bacteria 4029
137 Ga0501084_0206185 3300054114 Bacteria 1659
138 Ga0501082_0126732 3300060353 Bacteria 2214
139 Ga0530510_0252670 3300061734 Bacteria 1314
140 2525557627 2524614729 Bacteria 3091755
141 2630649218 2627854209 Bacteria 3093011
142 Ga0070685_10000555
143 Ga0065707_10360455
144 Ga0070658_10000010
145 Ga0070683_100001679
146 Ga0070680_100778442
147 Ga0070687_100228764
148 Ga0070675_100000020
149 Ga0070659_100055193
150 Ga0070701_10008957
151 Ga0070694_100111441
152 Ga0070662_100003270
153 Ga0070685_10018720
154 Ga0070698_100010391
155 Ga0070698_100035271
156 Ga0070686_100000017
157 Ga0070695_100034018
158 Ga0070704_100092938
159 Ga0070704_100859594
160 Ga0070664_100129239
161 Ga0068852_100239818
162 Ga0068859_100080771
163 Ga0068870_10152546
164 Ga0068863_100089676
165 Ga0068858_100113559
166 Ga0068860_100022532
167 Ga0068871_100239376
168 Ga0075428_100191359
169 Ga0075430_100013221
170 Ga0075430_100294355
171 Ga0075431_100001877
172 Ga0075431_100080455
173 Ga0075431_100242170
174 Ga0075429_100000233
175 Ga0075429_100113097
176 Ga0068865_100580199
177 Ga0097620_100080767
178 Ga0105244_10013172
179 Ga0111539_10069758
180 Ga0114129_10134160
181 Ga0105243_10036330
182 Ga0105242_10033427
183 Ga0105237_11139328
184 Ga0105238_10000069
185 Ga0157370_10041669
186 Ga0157378_10374486
187 Ga0213876_10017230
188 Ga0207655_1034018
189 Ga0207643_10153033
190 Ga0207705_10000016
191 Ga0207694_10000038
192 Ga0207659_10000035
193 Ga0207706_10005213
194 Ga0207686_10005495
195 Ga0207670_10614069
196 Ga0207679_10088184
197 Ga0207667_10097716
198 Ga0207703_10108232
199 Ga0207702_10154867
200 Ga0268264_10043280
201 Ga0265319_1003471
202 Ga0265318_10000717
203 Ga0307511_10032065
204 Ga0265330_10001927
205 Ga0265332_10000766
206 Ga0265320_10001527
207 Ga0265325_10053222
208 Ga0265329_10003762
209 Ga0265340_10004041
210 Ga0265339_10015559
211 Ga0265331_10001913
212 Ga0265316_10001666
213 Ga0265313_10000314
214 Ga0307508_10094102
215 Ga0265314_10004927
216 Ga0265342_10001765
217 Ga0316576_10082074
218 Ga0316576_10379161
219 Ga0307406_10511357
220 Ga0307412_10204927
221 Ga0307409_100161132
222 Ga0307416_100056325
223 Ga0307411_10215441
224 Ga0307507_10118495
225 Ga0373959_0000183
226 Ga0373932_0118778
227 Ga0373936_0054084
228 Ga0373961_0094626
229 Ga0373931_0364975
230 Ga0373937_0687392
231 Ga0316584_0449344
232 Ga0395899_0032281
233 Ga0395905_0174945
234 Ga0395901_0092796
235 Ga0436365_1411604
236 Ga0439441_021149
237 Ga0451577_0139787
238 Ga0466961_0187712
239 Ga0453684_0027148
240 Ga0453684_0034723
241 Ga0453684_0035588
242 Ga0453684_0091208
243 Ga0453684_0647573
244 Ga0451576_0335223
245 Ga0495664_0002420
246 Ga0495630_0095252
247 Ga0495586_0018174
248 Ga0495621_0037600
249 Ga0495634_0001254
250 Ga0495649_0374141
251 Ga0496100_0975012
252 Ga0496101_0071250
253 Ga0496111_0301934
254 Ga0496112_0341160
255 Ga0496113_0651731
256 Ga0501034_0065216
257 Ga0501034_0120124
258 Ga0501040_0436429
259 Ga0501041_0043829
260 Ga0501073_0199083
261 Ga0501075_0267620
262 Ga0501075_0289153
263 Ga0501075_0487407
264 Ga0501076_0086000
265 Ga0501202_049095
266 Ga0501080_0100013
267 Ga0501081_0216751
268 Ga0501081_0285024
269 nmdc:mga09592_283010_c1
270 nmdc:mga09592_436913_c1
271 nmdc:mga09592_7143_c1
272 nmdc:mga0qj67_155434_c1
273 nmdc:mga0qj67_4313_c1
274 nmdc:mga06r32_12110_c1
275 nmdc:mga06r32_1289535_c1
276 nmdc:mga06r32_164388_c1
277 nmdc:mga08y16_58464_c1
278 Ga0501084_0206185
279 Ga0501082_0126732
280 Ga0530510_0252670
281 2525557627
282 2630649218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iie-assembly1.cif.gz_A single chain integration host factor protein (scihf2) in complex with dna 0.4881 8 108
3wfq-assembly4.cif.gz_H trna processing enzyme complex 1 0.3606 59 196
8sc2-assembly1.cif.gz_A human oct1 bound to diltiazem in inward-open conformation 0.2927 3 196
6m2l-assembly2.cif.gz_B crystal structure of plasmodium falciparum hexose transporter pfht1 bound with c3361 0.2856 3 196
8jd4-assembly1.cif.gz_2 cryo-em structure of g protein-free mglu2-mglu4 heterodimer in acc state 0.2777 69 196
ID Description Score Start End Superfamily
af_F1M8T9_26_319_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3161 5 194 1.20.1070.10
af_O01611_11_311_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3126 2 195 1.20.1070.10
af_Q54BT0_147_432_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3021 22 196 1.20.1070.10
af_A0A2R8PZ54_30_330_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.302 3 196 1.20.1070.10
af_O01611_11_311_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2999 2 195 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7J5F0K5-F1-model_v4 Metal-dependent hydrolase 0.9617 1 115 GO:0016020
AF-A0A2V6LGK4-F1-model_v4 Metal-dependent hydrolase 0.9608 1 144 GO:0016020
AF-A0A4Q3BXX3-F1-model_v4 Metal-dependent hydrolase 0.9603 1 152 GO:0016020
AF-A0A2V5JB87-F1-model_v4 Metal-dependent hydrolase 0.9589 1 146 GO:0016020
AF-A0A349X8V1-F1-model_v4 Uncharacterized protein 0.9552 1 123 GO:0016020

Map