F180207

General Info

Members Datasets Scaffolds Average Seq Length
140 87 281 300

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0005340|Ga0395901_0005340_806_1810
Length 334
Sequence MCQLLQAALHLSRPTTYYFSNNPLSLNMAVLDSYKKGFAIYLQIEKGLSVNTQENYLRDVDKLFEFLSFNYPDTSLQKTELQHLSAFLNWVAEIGLSAASQARIMSGIKSFFTYLVNEDIITADPSELLITPKLKRKLPEVLSIEEIDAMLNAIDRSKPEGERNKAMLEVLYSSGLRVSELTGLQLSNVFLDEGLLRIIGKGNKERLVPIGSSASDQLDLYLKHVRVHIPIQHGMSDIVFLNKRGTSLSRVYVFTLIKNLASEVGIKKNISPHTFRHSFATHLVEGGADLRAVQEMLGHESITTTEIYTHLDRNYLKEVIAQFHPRGKRNPKSV

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
61 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
65 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
66 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
67 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
68 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
69 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
70 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
71 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
72 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
73 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
74 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
75 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
76 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
77 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
78 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
79 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
80 2738541283 Pedobacter sp. OK701 Isolate Unclassified
81 2738541284 Pedobacter sp. YR016 Isolate Unclassified
82 2738543023 Pedobacter sp. OK628 Isolate Unclassified
83 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
84 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
85 2914759650 Rhizosphaericola mali Isolate Rhizosphere
86 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
87 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.14
Metatranscriptomes 1.43
Isolates 6.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 0
Rhizosphere 80.71
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0005340 3300038443 Bacteria 12983
2 SwRhRL2b_contig_171724 2162886007 Bacteria 8039
3 rootH1_10003833 3300003316 Bacteria 7317
4 rootH2_10021704 3300003320 Bacteria 49464
5 rootH2_10275491 3300003320 Bacteria 2528
6 rootL2_10031125 3300003322 Bacteria 7051
7 rootL2_10097466 3300003322 Bacteria 2425
8 rootH1_10004539 3300003323 Bacteria 50349
9 rootH1_10015499 3300003323 Bacteria 86587
10 rootH1_10073454 3300003316 Bacteria 6341
11 rootH1_10073454 3300003323 Bacteria 16546
12 Ga0055536_1010110 3300003781 Bacteria 3794
13 Ga0055530_10046452 3300003791 Bacteria 1031
14 Ga0065165_1000164 3300005262 Bacteria 115939
15 Ga0065165_1001087 3300005262 Bacteria 32424
16 Ga0065714_10005951 3300005288 Bacteria 7262
17 Ga0065714_10078498 3300005288 Bacteria 2594
18 Ga0065704_10000288 3300005289 Bacteria 77379
19 Ga0065704_10081201 3300005289 Bacteria 3804
20 Ga0065715_10121871 3300005293 Bacteria 2219
21 Ga0070658_10194212 3300005327 Bacteria 1712
22 Ga0070658_10245369 3300005327 Bacteria 1519
23 Ga0070682_100095398 3300005337 Bacteria 1953
24 Ga0070671_100247162 3300005355 Unclassified 1515
25 Ga0070679_100220141 3300005530 Bacteria 1859
26 Ga0068855_100443527 3300005563 Bacteria 1417
27 Ga0068856_100029073 3300005614 Bacteria 5400
28 Ga0068852_100180459 3300005616 Bacteria 1985
29 Ga0068852_100670406 3300005616 Bacteria 1046
30 Ga0075428_100139397 3300006844 Bacteria 2636
31 Ga0111539_10013200 3300009094 Bacteria 10329
32 Ga0111539_10244049 3300009094 Bacteria 2091
33 Ga0105237_10036675 3300009545 Bacteria 4961
34 Ga0105249_10485012 3300009553 Bacteria 1279
35 Ga0157373_10000043 3300013100 Bacteria 113422
36 Ga0157371_10002094 3300013102 Bacteria 19489
37 Ga0157371_10077155 3300013102 Bacteria 2359
38 Ga0157370_10003446 3300013104 Bacteria 18565
39 Ga0157370_10005009 3300013104 Bacteria 14976
40 Ga0157370_10145038 3300013104 Bacteria 2211
41 Ga0157370_10311956 3300013104 Bacteria 1451
42 Ga0157374_10020181 3300013296 Bacteria 5909
43 Ga0157375_10301233 3300013308 Unclassified 1767
44 Ga0157380_10000541 3300014326 Bacteria 23268
45 Ga0157380_10001533 3300014326 Bacteria 15182
46 Ga0182008_10000001 3300014497 Bacteria 540790
47 Ga0182008_10000658 3300014497 Bacteria 25096
48 Ga0182006_1023355 3300015261 Bacteria 2562
49 Ga0163161_10065204 3300017792 Bacteria 2658
50 Ga0163161_10334446 3300017792 Bacteria 1200
51 Ga0213876_10005830 3300021384 Bacteria 6745
52 Ga0209676_1001626 3300025292 Bacteria 19863
53 Ga0209050_1001692 3300025298 Bacteria 22112
54 Ga0207705_10187023 3300025909 Bacteria 1565
55 Ga0207671_10097654 3300025914 Bacteria 2221
56 Ga0207644_10071786 3300025931 Unclassified 2534
57 Ga0207686_10027128 3300025934 Bacteria 3351
58 Ga0207677_10036067 3300026023 Bacteria 3219
59 Ga0207702_10021299 3300026078 Bacteria 5366
60 Ga0207698_10084225 3300026142 Bacteria 2577
61 Ga0207428_10070162 3300027907 Bacteria 2754
62 Ga0265334_10054781 3300028573 Bacteria 1520
63 Ga0265327_10031093 3300031251 Bacteria 3006
64 Ga0307513_10022340 3300031456 Bacteria 7440
65 Ga0307513_10133814 3300031456 Bacteria 2419
66 Ga0316576_10275419 3300031727 Bacteria 1261
67 Ga0307405_10026150 3300031731 Bacteria 3363
68 Ga0307413_10282693 3300031824 Bacteria 1249
69 Ga0307406_10158697 3300031901 Bacteria 1623
70 Ga0307407_10119745 3300031903 Bacteria 1667
71 Ga0307412_10000033 3300031911 Bacteria 206649
72 Ga0307412_10041842 3300031911 Bacteria 2972
73 Ga0307412_10158092 3300031911 Bacteria 1680
74 Ga0307412_10244838 3300031911 Unclassified 1389
75 Ga0307416_100000246 3300032002 Bacteria 28754
76 Ga0307414_10000235 3300032004 Bacteria 35379
77 Ga0307414_10002459 3300032004 Bacteria 9703
78 Ga0307414_10021989 3300032004 Bacteria 4013
79 Ga0307414_10062318 3300032004 Bacteria 2646
80 Ga0307415_100073463 3300032126 Unclassified 2413
81 Ga0316593_10088502 3300032168 Bacteria 1088
82 Ga0316588_1040034 3300033528 Bacteria 1119
83 Ga0436365_0335685 3300039437 Bacteria 5469
84 Ga0436365_1522862 3300039437 Bacteria 1138
85 Ga0451577_0013136 3300042876 Bacteria 7760
86 Ga0451577_0016167 3300042876 Bacteria 6916
87 Ga0451577_0101207 3300042876 Bacteria 2575
88 Ga0451577_0151319 3300042876 Bacteria 2088
89 Ga0451577_0179430 3300042876 Bacteria 1909
90 Ga0451577_0210339 3300042876 Bacteria 1757
91 Ga0451577_0220489 3300042876 Bacteria 1714
92 Ga0466982_0061857 3300044672 Bacteria 2305
93 Ga0453683_0000015 3300044673 Bacteria 346024
94 Ga0453683_0000483 3300044673 Bacteria 45636
95 Ga0453683_0041983 3300044673 Bacteria 2872
96 Ga0453683_0058025 3300044673 Bacteria 2421
97 Ga0453684_0000086 3300044712 Bacteria 397278
98 Ga0453684_0000288 3300044712 Bacteria 216718
99 Ga0453684_0000676 3300044712 Bacteria 122215
100 Ga0453684_0000921 3300044712 Bacteria 97511
101 Ga0453684_0001251 3300044712 Bacteria 76833
102 Ga0453684_0002828 3300044712 Bacteria 40931
103 Ga0453684_0003574 3300044712 Bacteria 34713
104 Ga0453684_0014217 3300044712 Bacteria 12776
105 Ga0453684_0018140 3300044712 Bacteria 10832
106 Ga0453684_0033783 3300044712 Bacteria 7119
107 Ga0453684_0143720 3300044712 Bacteria 2845
108 Ga0453684_0195733 3300044712 Bacteria 2361
109 Ga0453684_0528338 3300044712 Bacteria 1302
110 Ga0453684_0555776 3300044712 Bacteria 1264
111 Ga0451576_0000083 3300045051 Bacteria 236908
112 Ga0451576_0000423 3300045051 Bacteria 97511
113 Ga0451576_0010060 3300045051 Bacteria 10890
114 Ga0451576_0046289 3300045051 Bacteria 4581
115 Ga0451576_0177310 3300045051 Bacteria 2225
116 Ga0451576_0211307 3300045051 Bacteria 2026
117 Ga0495638_0000197 3300046460 Bacteria 86853
118 Ga0495609_0027579 3300046538 Bacteria 2595
119 Ga0495634_0100995 3300046642 Bacteria 1864
120 Ga0495686_0004111 3300047472 Bacteria 12115
121 Ga0496122_0001345 3300048925 Bacteria 40096
122 Ga0496123_0089850 3300048926 Bacteria 1828
123 Ga0501299_016232 3300049522 Unclassified 1317
124 Ga0501300_001447 3300049523 Bacteria 3552
125 Ga0501217_001516 3300049661 Bacteria 4376
126 Ga0501253_028762 3300049683 Unclassified 1043
127 Ga0501225_0003184 3300049705 Bacteria 5015
128 Ga0501241_003925 3300049758 Bacteria 2799
129 nmdc:mga08y16_180972_c1 3300050511 Bacteria 2189
130 nmdc:mga08y16_29909_c1 3300050511 Bacteria 5736
131 Ga0500618_017734 3300053125 Bacteria 1768
132 Ga0500616_0000051 3300053153 Bacteria 296240
133 2522548148 2522125168 Bacteria 7376607
134 2738754817 2738541283 Bacteria 7222293
135 2738761268 2738541284 Bacteria 5199923
136 2739305151 2738543023 Bacteria 6767879
137 2910247112 2910245624 Bacteria 6935613
138 2911141072 2911138879 Bacteria 5811561
139 2914762323 2914759650 Bacteria 4701441
140 2919187043 2919186247 Bacteria 6244071
141 2939665688 2939664404 Bacteria 6364494
142 Ga0395901_0005340
143 SwRhRL2b_contig_171724
144 rootH1_10003833
145 rootH2_10021704
146 rootH2_10275491
147 rootL2_10031125
148 rootL2_10097466
149 rootH1_10004539
150 rootH1_10015499
151 rootH1_10073454
152 Ga0055536_1010110
153 Ga0055530_10046452
154 Ga0065165_1000164
155 Ga0065165_1001087
156 Ga0065714_10005951
157 Ga0065714_10078498
158 Ga0065704_10000288
159 Ga0065704_10081201
160 Ga0065715_10121871
161 Ga0070658_10194212
162 Ga0070658_10245369
163 Ga0070682_100095398
164 Ga0070671_100247162
165 Ga0070679_100220141
166 Ga0068855_100443527
167 Ga0068856_100029073
168 Ga0068852_100180459
169 Ga0068852_100670406
170 Ga0075428_100139397
171 Ga0111539_10013200
172 Ga0111539_10244049
173 Ga0105237_10036675
174 Ga0105249_10485012
175 Ga0157373_10000043
176 Ga0157371_10002094
177 Ga0157371_10077155
178 Ga0157370_10003446
179 Ga0157370_10005009
180 Ga0157370_10145038
181 Ga0157370_10311956
182 Ga0157374_10020181
183 Ga0157375_10301233
184 Ga0157380_10000541
185 Ga0157380_10001533
186 Ga0182008_10000001
187 Ga0182008_10000658
188 Ga0182006_1023355
189 Ga0163161_10065204
190 Ga0163161_10334446
191 Ga0213876_10005830
192 Ga0209676_1001626
193 Ga0209050_1001692
194 Ga0207705_10187023
195 Ga0207671_10097654
196 Ga0207644_10071786
197 Ga0207686_10027128
198 Ga0207677_10036067
199 Ga0207702_10021299
200 Ga0207698_10084225
201 Ga0207428_10070162
202 Ga0265334_10054781
203 Ga0265327_10031093
204 Ga0307513_10022340
205 Ga0307513_10133814
206 Ga0316576_10275419
207 Ga0307405_10026150
208 Ga0307413_10282693
209 Ga0307406_10158697
210 Ga0307407_10119745
211 Ga0307412_10000033
212 Ga0307412_10041842
213 Ga0307412_10158092
214 Ga0307412_10244838
215 Ga0307416_100000246
216 Ga0307414_10000235
217 Ga0307414_10002459
218 Ga0307414_10021989
219 Ga0307414_10062318
220 Ga0307415_100073463
221 Ga0316593_10088502
222 Ga0316588_1040034
223 Ga0436365_0335685
224 Ga0436365_1522862
225 Ga0451577_0013136
226 Ga0451577_0016167
227 Ga0451577_0101207
228 Ga0451577_0151319
229 Ga0451577_0179430
230 Ga0451577_0210339
231 Ga0451577_0220489
232 Ga0466982_0061857
233 Ga0453683_0000015
234 Ga0453683_0000483
235 Ga0453683_0041983
236 Ga0453683_0058025
237 Ga0453684_0000086
238 Ga0453684_0000288
239 Ga0453684_0000676
240 Ga0453684_0000921
241 Ga0453684_0001251
242 Ga0453684_0002828
243 Ga0453684_0003574
244 Ga0453684_0014217
245 Ga0453684_0018140
246 Ga0453684_0033783
247 Ga0453684_0143720
248 Ga0453684_0195733
249 Ga0453684_0528338
250 Ga0453684_0555776
251 Ga0451576_0000083
252 Ga0451576_0000423
253 Ga0451576_0010060
254 Ga0451576_0046289
255 Ga0451576_0177310
256 Ga0451576_0211307
257 Ga0495638_0000197
258 Ga0495609_0027579
259 Ga0495634_0100995
260 Ga0495686_0004111
261 Ga0496122_0001345
262 Ga0496123_0089850
263 Ga0501299_016232
264 Ga0501300_001447
265 Ga0501217_001516
266 Ga0501253_028762
267 Ga0501225_0003184
268 Ga0501241_003925
269 nmdc:mga08y16_180972_c1
270 nmdc:mga08y16_29909_c1
271 Ga0500618_017734
272 Ga0500616_0000051
273 2522548148
274 2738754817
275 2738761268
276 2739305151
277 2910247112
278 2911141072
279 2914762323
280 2919187043
281 2939665688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

36

119

0.97

PF00589

Phage_integrase

Phage integrase family

140

314

0.96

PF13495

Phage_int_SAM_4

Phage integrase, N-terminal SAM-like domain

36

122

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.8776 7 104
8h43-assembly3.cif.gz_C crystal structure of phf1 tudor domain in complex with hit 1 0.8264 160 181
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.8018 7 104
3nkh-assembly1.cif.gz_B crystal structure of integrase from mrsa strain staphylococcus aureus 0.7898 113 294
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.7873 6 105
ID Description Score Start End Superfamily
af_P9WF35_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9508 4 99 1.10.150.130
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9482 4 98 1.10.150.130
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9346 4 98 1.10.150.130
af_P9WF35_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9317 4 99 1.10.150.130
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9292 4 98 1.10.150.130
ID Description Score Start End GO Terms
AF-X1KSG8-F1-model_v4 Tyr recombinase domain-containing protein 0.9609 110 251 GO:0003677
GO:0006310
GO:0015074
AF-X1KSG8-F1-model_v4 Tyr recombinase domain-containing protein 0.9479 110 251 GO:0003677
GO:0006310
GO:0015074
AF-A0A2E7AS56-F1-model_v4 Tyr recombinase domain-containing protein 0.9446 109 273 GO:0003677
GO:0006310
GO:0015074
AF-A0A3D4K0B9-F1-model_v4 deleted 0.9204 145 270
AF-X0W4D5-F1-model_v4 Tyr recombinase domain-containing protein 0.9072 88 232 GO:0003677
GO:0006310
GO:0015074

Map