F175646

General Info

Members Datasets Scaffolds Average Seq Length
139 91 278 130

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100154231|Ga0070707_1001542311
Length 155
Sequence VRALYANQFPLADRKGATTPERIEKDEIMNEGAKQIERVRRICLSLPETWEKISHGEPTWFVGKKVFAMFSNNHHHDGHIAVTIPAAIGVQEALIKKSPKKFYRPPYVGVRGWVGVEVDRVTDKELTVHLREAWKLIAPPKLHQLLAVEPAAKRK

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
81 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
82 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
86 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
91 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.16
Rhizosphere 97.12
Stem 0
Stem Tuber 0
Unclassified 33.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100154231 3300005468 Unclassified 2237
2 LJNas_1018948 3300000546 Unclassified 733
3 JGI24748J21848_1000001 3300002074 Bacteria 444271
4 JGI24034J26672_10000001 3300002239 Bacteria 1118280
5 Ga0065715_10532972 3300005293 Bacteria 754
6 Ga0070690_100086661 3300005330 Unclassified 2056
7 Ga0070690_100212524 3300005330 Unclassified 1351
8 Ga0070690_100342894 3300005330 Bacteria 1082
9 Ga0068868_100229785 3300005338 Bacteria 1556
10 Ga0070687_100046262 3300005343 Bacteria 2227
11 Ga0070687_100177205 3300005343 Bacteria 1274
12 Ga0070661_100913098 3300005344 Bacteria 725
13 Ga0070669_100347407 3300005353 Bacteria 1203
14 Ga0070669_100770647 3300005353 Unclassified 816
15 Ga0070673_100313894 3300005364 Bacteria 1383
16 Ga0070703_10000032 3300005406 Bacteria 67514
17 Ga0070713_100295064 3300005436 Bacteria 1491
18 Ga0070701_10785820 3300005438 Unclassified 648
19 Ga0070700_100003973 3300005441 Bacteria 7683
20 Ga0070700_100268713 3300005441 Bacteria 1231
21 Ga0070694_100000749 3300005444 Bacteria 18198
22 Ga0070708_100453380 3300005445 Unclassified 1210
23 Ga0068867_100741828 3300005459 Unclassified 870
24 Ga0070706_100851454 3300005467 Bacteria 843
25 Ga0070707_101637022 3300005468 Unclassified 611
26 Ga0070697_100001053 3300005536 Bacteria 20830
27 Ga0070697_100006222 3300005536 Bacteria 9242
28 Ga0070686_100118453 3300005544 Bacteria 1815
29 Ga0070695_100474049 3300005545 Bacteria 963
30 Ga0070693_100109501 3300005547 Unclassified 1697
31 Ga0070665_100062775 3300005548 Bacteria 3724
32 Ga0070704_100020834 3300005549 Unclassified 4238
33 Ga0070702_100046195 3300005615 Unclassified 2467
34 Ga0070702_100338701 3300005615 Bacteria 1055
35 Ga0068858_100000089 3300005842 Bacteria 94932
36 Ga0068860_100160254 3300005843 Bacteria 2169
37 Ga0068860_100185277 3300005843 Bacteria 2013
38 Ga0068860_100484657 3300005843 Unclassified 1233
39 Ga0068860_100584564 3300005843 Bacteria 1121
40 Ga0068862_100541461 3300005844 Bacteria 1110
41 Ga0070717_11962800 3300006028 Unclassified 528
42 Ga0070716_100014761 3300006173 Unclassified 4007
43 Ga0070716_100229509 3300006173 Bacteria 1252
44 Ga0070716_100656132 3300006173 Bacteria 796
45 Ga0097621_101403504 3300006237 Unclassified 661
46 Ga0075428_100331642 3300006844 Unclassified 1634
47 Ga0075431_100195988 3300006847 Unclassified 2068
48 Ga0075433_10293003 3300006852 Unclassified 1441
49 Ga0075429_100069171 3300006880 Unclassified 3074
50 Ga0075429_100399279 3300006880 Bacteria 1204
51 Ga0075436_100000002 3300006914 Bacteria 475522
52 Ga0075436_100345422 3300006914 Unclassified 1072
53 Ga0075436_100551099 3300006914 Unclassified 846
54 Ga0075435_100000884 3300007076 Bacteria 18810
55 Ga0099795_10497173 3300007788 Unclassified 568
56 Ga0111539_11903873 3300009094 Unclassified 690
57 Ga0105247_10000002 3300009101 Bacteria 724587
58 Ga0114129_10205460 3300009147 Bacteria 2665
59 Ga0114129_10507112 3300009147 Unclassified 1575
60 Ga0114129_10658464 3300009147 Unclassified 1351
61 Ga0114129_12043624 3300009147 Unclassified 692
62 Ga0114129_12888771 3300009147 Unclassified 568
63 Ga0105243_10000015 3300009148 Bacteria 251115
64 Ga0105243_10000131 3300009148 Bacteria 85514
65 Ga0105243_10163760 3300009148 Bacteria 1920
66 Ga0105242_10000028 3300009176 Bacteria 106293
67 Ga0105242_10000071 3300009176 Bacteria 71591
68 Ga0105242_10589568 3300009176 Bacteria 1072
69 Ga0105249_10879605 3300009553 Unclassified 962
70 Ga0105239_11754953 3300010375 Bacteria 719
71 Ga0157369_10423680 3300013105 Bacteria 1380
72 Ga0157378_10000017 3300013297 Bacteria 139053
73 Ga0157378_10072712 3300013297 Bacteria 3090
74 Ga0157378_10795756 3300013297 Unclassified 971
75 Ga0163162_10127032 3300013306 Bacteria 2657
76 Ga0163162_10194177 3300013306 Bacteria 2158
77 Ga0157375_10001644 3300013308 Bacteria 19220
78 Ga0157380_10063665 3300014326 Bacteria 2958
79 Ga0157380_10826707 3300014326 Unclassified 946
80 Ga0157379_10108592 3300014968 Bacteria 2491
81 Ga0157376_10184592 3300014969 Bacteria 1909
82 Ga0207653_10000044 3300025885 Bacteria 94983
83 Ga0207642_10008071 3300025899 Bacteria 3591
84 Ga0207699_10511541 3300025906 Unclassified 868
85 Ga0207649_11261733 3300025920 Bacteria 584
86 Ga0207646_10034555 3300025922 Unclassified 4569
87 Ga0207686_10000031 3300025934 Bacteria 158735
88 Ga0207686_10001646 3300025934 Bacteria 12473
89 Ga0207686_11080317 3300025934 Bacteria 654
90 Ga0207709_10000009 3300025935 Bacteria 619238
91 Ga0207709_10000480 3300025935 Bacteria 36411
92 Ga0207665_10006668 3300025939 Bacteria 7660
93 Ga0207665_10128938 3300025939 Bacteria 1793
94 Ga0207711_10876525 3300025941 Bacteria 835
95 Ga0207711_11549840 3300025941 Unclassified 606
96 Ga0207651_10130782 3300025960 Bacteria 1921
97 Ga0207651_11114963 3300025960 Unclassified 707
98 Ga0207712_10063359 3300025961 Bacteria 2632
99 Ga0207712_12049355 3300025961 Unclassified 512
100 Ga0207708_10007568 3300026075 Bacteria 8034
101 Ga0207708_10158529 3300026075 Unclassified 1786
102 Ga0207648_10124853 3300026089 Unclassified 2264
103 Ga0207648_10280237 3300026089 Unclassified 1491
104 Ga0207676_11097629 3300026095 Bacteria 786
105 Ga0207675_100136678 3300026118 Bacteria 2326
106 Ga0268266_10606891 3300028379 Unclassified 1051
107 Ga0268265_10937421 3300028380 Bacteria 852
108 Ga0268264_10087632 3300028381 Bacteria 2677
109 Ga0268264_10149150 3300028381 Bacteria 2095
110 Ga0268264_10469210 3300028381 Bacteria 1222
111 Ga0268264_10527827 3300028381 Bacteria 1155
112 Ga0307513_10688944 3300031456 Bacteria 728
113 Ga0307412_11555749 3300031911 Unclassified 603
114 Ga0307414_11451753 3300032004 Unclassified 638
115 Ga0451793_1751271 3300041452 Bacteria 736
116 Ga0451577_0433158 3300042876 Bacteria 1194
117 Ga0453683_0038338 3300044673 Bacteria 3013
118 Ga0451576_0380767 3300045051 Bacteria 1479
119 Ga0495656_0042863 3300046615 Bacteria 1897
120 Ga0495670_0380928 3300046691 Unclassified 761
121 Ga0495636_0572090 3300047318 Bacteria 551
122 Ga0495672_0003667 3300047320 Bacteria 12981
123 Ga0495672_0014564 3300047320 Bacteria 5378
124 Ga0496101_0368149 3300048904 Bacteria 1130
125 Ga0496106_0004834 3300048909 Bacteria 9969
126 Ga0501241_119561 3300049758 Unclassified 584
127 nmdc:mga05p37_150238_c1 3300050507 Bacteria 2850
128 nmdc:mga05p37_415288_c1 3300050507 Unclassified 1567
129 nmdc:mga05p37_67369_c1 3300050507 Bacteria 4404
130 nmdc:mga09592_159894_c1 3300050508 Bacteria 1946
131 nmdc:mga09592_35969_c1 3300050508 Bacteria 4147
132 nmdc:mga09592_366003_c1 3300050508 Bacteria 1247
133 nmdc:mga08y16_1622226_c1 3300050511 Unclassified 604
134 nmdc:mga0n895_1141142_c1 3300050512 Unclassified 755
135 nmdc:mga0rr50_4475_c1 3300050513 Bacteria 8226
136 nmdc:mga0rr50_91332_c1 3300050513 Bacteria 2371
137 nmdc:mga08x19_343443_c1 3300050514 Bacteria 1041
138 nmdc:mga08x19_5104_c1 3300050514 Bacteria 7763
139 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
140 Ga0070707_100154231
141 LJNas_1018948
142 JGI24748J21848_1000001
143 JGI24034J26672_10000001
144 Ga0065715_10532972
145 Ga0070690_100086661
146 Ga0070690_100212524
147 Ga0070690_100342894
148 Ga0068868_100229785
149 Ga0070687_100046262
150 Ga0070687_100177205
151 Ga0070661_100913098
152 Ga0070669_100347407
153 Ga0070669_100770647
154 Ga0070673_100313894
155 Ga0070703_10000032
156 Ga0070713_100295064
157 Ga0070701_10785820
158 Ga0070700_100003973
159 Ga0070700_100268713
160 Ga0070694_100000749
161 Ga0070708_100453380
162 Ga0068867_100741828
163 Ga0070706_100851454
164 Ga0070707_101637022
165 Ga0070697_100001053
166 Ga0070697_100006222
167 Ga0070686_100118453
168 Ga0070695_100474049
169 Ga0070693_100109501
170 Ga0070665_100062775
171 Ga0070704_100020834
172 Ga0070702_100046195
173 Ga0070702_100338701
174 Ga0068858_100000089
175 Ga0068860_100160254
176 Ga0068860_100185277
177 Ga0068860_100484657
178 Ga0068860_100584564
179 Ga0068862_100541461
180 Ga0070717_11962800
181 Ga0070716_100014761
182 Ga0070716_100229509
183 Ga0070716_100656132
184 Ga0097621_101403504
185 Ga0075428_100331642
186 Ga0075431_100195988
187 Ga0075433_10293003
188 Ga0075429_100069171
189 Ga0075429_100399279
190 Ga0075436_100000002
191 Ga0075436_100345422
192 Ga0075436_100551099
193 Ga0075435_100000884
194 Ga0099795_10497173
195 Ga0111539_11903873
196 Ga0105247_10000002
197 Ga0114129_10205460
198 Ga0114129_10507112
199 Ga0114129_10658464
200 Ga0114129_12043624
201 Ga0114129_12888771
202 Ga0105243_10000015
203 Ga0105243_10000131
204 Ga0105243_10163760
205 Ga0105242_10000028
206 Ga0105242_10000071
207 Ga0105242_10589568
208 Ga0105249_10879605
209 Ga0105239_11754953
210 Ga0157369_10423680
211 Ga0157378_10000017
212 Ga0157378_10072712
213 Ga0157378_10795756
214 Ga0163162_10127032
215 Ga0163162_10194177
216 Ga0157375_10001644
217 Ga0157380_10063665
218 Ga0157380_10826707
219 Ga0157379_10108592
220 Ga0157376_10184592
221 Ga0207653_10000044
222 Ga0207642_10008071
223 Ga0207699_10511541
224 Ga0207649_11261733
225 Ga0207646_10034555
226 Ga0207686_10000031
227 Ga0207686_10001646
228 Ga0207686_11080317
229 Ga0207709_10000009
230 Ga0207709_10000480
231 Ga0207665_10006668
232 Ga0207665_10128938
233 Ga0207711_10876525
234 Ga0207711_11549840
235 Ga0207651_10130782
236 Ga0207651_11114963
237 Ga0207712_10063359
238 Ga0207712_12049355
239 Ga0207708_10007568
240 Ga0207708_10158529
241 Ga0207648_10124853
242 Ga0207648_10280237
243 Ga0207676_11097629
244 Ga0207675_100136678
245 Ga0268266_10606891
246 Ga0268265_10937421
247 Ga0268264_10087632
248 Ga0268264_10149150
249 Ga0268264_10469210
250 Ga0268264_10527827
251 Ga0307513_10688944
252 Ga0307412_11555749
253 Ga0307414_11451753
254 Ga0451793_1751271
255 Ga0451577_0433158
256 Ga0453683_0038338
257 Ga0451576_0380767
258 Ga0495656_0042863
259 Ga0495670_0380928
260 Ga0495636_0572090
261 Ga0495672_0003667
262 Ga0495672_0014564
263 Ga0496101_0368149
264 Ga0496106_0004834
265 Ga0501241_119561
266 nmdc:mga05p37_150238_c1
267 nmdc:mga05p37_415288_c1
268 nmdc:mga05p37_67369_c1
269 nmdc:mga09592_159894_c1
270 nmdc:mga09592_35969_c1
271 nmdc:mga09592_366003_c1
272 nmdc:mga08y16_1622226_c1
273 nmdc:mga0n895_1141142_c1
274 nmdc:mga0rr50_4475_c1
275 nmdc:mga0rr50_91332_c1
276 nmdc:mga08x19_343443_c1
277 nmdc:mga08x19_5104_c1
278 nmdc:mga08x19_9_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

44

136

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.8483 13 114
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7947 24 113
2kfp-assembly1.cif.gz_A solution nmr structure of pspto_3016 from pseudomonas syringae. northeast structural genomics consortium target psr293. 0.7722 32 113
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.7239 13 125
6lnw-assembly1.cif.gz_A crystal structure of accessory secretory protein 1,2 and 3 in streptococcus pneumoniae 0.7061 24 61
ID Description Score Start End Superfamily
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8484 13 114 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.838 13 122 3.90.1150.30
4n06B01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2;CRISPR-associated endonuclease Cas1, N-terminal domain 0.8366 25 46 3.100.10.20
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.836 8 122 3.90.1150.30
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8309 14 119 3.30.70.1230
ID Description Score Start End GO Terms
AF-A0A2V8LB27-F1-model_v4 Phosphoribosylglycinamide formyltransferase 0.9696 6 121 GO:0016740
AF-A0A7Y5KBU2-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.962 9 120 GO:0003677
AF-A0A3N5S5A9-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9595 9 125 GO:0003677
AF-A0A841GKG9-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9549 11 122
AF-A0A3N1JVS3-F1-model_v4 deleted 0.9546 9 122

Map