F174689

General Info

Members Datasets Scaffolds Average Seq Length
138 115 276 190

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0204382|Ga0500616_0204382_59_655
Length 198
Sequence MRRKGRSMTDFEKRLRTDLEPLLASPDPREKISAYHDMPYALFRYDPEQEFPLRREITMLTTRLTQKGKRITRISLAQCLHEAITSQRPLEDWYEAEQAGTVEDTVQTITNILEERAPLVDLVAKRMPSSPDPRTDVVLINRTGALFPVYRTFSLLEQLKGRVLVPTILFYPGDLDGAAGLRFMGVLDAEHNYRPKIF

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
27 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
28 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
29 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
30 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
39 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
44 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
47 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
48 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
49 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
53 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
61 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
62 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
76 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
77 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
81 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
82 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
83 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
104 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
105 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
108 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
109 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
110 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
111 2902330777 Methylobacterium sp. 2A Isolate Unclassified
112 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
113 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
114 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
115 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 0.72
Isolates 6.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 7.97
Rhizoplane 0
Rhizosphere 73.19
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0204382 3300053153 Bacteria 873
2 rootH1_10009044 3300003316 Bacteria 1217
3 rootL2_10124354 3300003322 Bacteria 3854
4 rootL2_10378268 3300003322 Bacteria 1512
5 Ga0070690_100334232 3300005330 Bacteria 1095
6 Ga0070707_100001163 3300005468 Bacteria 25878
7 Ga0070698_100001184 3300005471 Bacteria 28906
8 Ga0070698_100001332 3300005471 Bacteria 27496
9 Ga0070699_100000304 3300005518 Bacteria 47718
10 Ga0070697_100014202 3300005536 Bacteria 6256
11 Ga0070695_100008150 3300005545 Bacteria 6209
12 Ga0070665_100079446 3300005548 Bacteria 3286
13 Ga0068856_101527618 3300005614 Unclassified 681
14 Ga0068863_100241251 3300005841 Bacteria 1744
15 Ga0068858_100000019 3300005842 Bacteria 180988
16 Ga0075431_100366718 3300006847 Bacteria 1446
17 Ga0075433_10108946 3300006852 Bacteria 2457
18 Ga0099794_10042230 3300007265 Bacteria 2173
19 Ga0105240_10000993 3300009093 Bacteria 50641
20 Ga0105240_10941027 3300009093 Bacteria 927
21 Ga0111539_10063187 3300009094 Bacteria 4382
22 Ga0111539_10252507 3300009094 Bacteria 2053
23 Ga0105245_10050545 3300009098 Bacteria 3726
24 Ga0114129_10196808 3300009147 Bacteria 2732
25 Ga0114129_10297463 3300009147 Bacteria 2152
26 Ga0105237_10002037 3300009545 Bacteria 25698
27 Ga0105239_10330082 3300010375 Bacteria 1721
28 Ga0157370_10003523 3300013104 Bacteria 18349
29 Ga0157375_10852292 3300013308 Bacteria 1058
30 Ga0157379_10000335 3300014968 Bacteria 37706
31 Ga0214544_1000879 3300021320 Bacteria 59276
32 Ga0214542_1000838 3300021321 Bacteria 59276
33 Ga0214545_1000599 3300021324 Bacteria 59276
34 Ga0214543_1000692 3300021327 Bacteria 59276
35 Ga0228710_1002682 3300022740 Bacteria 28193
36 Ga0207695_10001475 3300025913 Bacteria 39357
37 Ga0207671_10001652 3300025914 Bacteria 25374
38 Ga0207646_10002413 3300025922 Bacteria 22055
39 Ga0207687_10041638 3300025927 Bacteria 3155
40 Ga0207703_10000036 3300026035 Bacteria 181013
41 Ga0207641_10324729 3300026088 Bacteria 1460
42 Ga0268266_10075191 3300028379 Bacteria 2934
43 Ga0265337_1008032 3300028556 Bacteria 3881
44 Ga0265319_1007831 3300028563 Bacteria 4750
45 Ga0265318_10000483 3300028577 Bacteria 29390
46 Ga0265323_10063540 3300028653 Bacteria 1278
47 Ga0265338_10069518 3300028800 Bacteria 3025
48 Ga0265330_10002880 3300031235 Bacteria 9195
49 Ga0265330_10006921 3300031235 Bacteria 5570
50 Ga0265332_10031128 3300031238 Bacteria 2328
51 Ga0265320_10005888 3300031240 Bacteria 7805
52 Ga0265320_10022304 3300031240 Bacteria 3389
53 Ga0265325_10004524 3300031241 Bacteria 8763
54 Ga0265329_10005386 3300031242 Bacteria 5176
55 Ga0265340_10000778 3300031247 Bacteria 18119
56 Ga0265339_10008429 3300031249 Bacteria 6558
57 Ga0265339_10069064 3300031249 Bacteria 1887
58 Ga0265331_10009465 3300031250 Bacteria 5467
59 Ga0265331_10129191 3300031250 Bacteria 1153
60 Ga0265316_10006345 3300031344 Bacteria 11310
61 Ga0265313_10216869 3300031595 Bacteria 790
62 Ga0316575_10024575 3300031665 Bacteria 2333
63 Ga0316579_10017247 3300031691 Bacteria 3164
64 Ga0265314_10000150 3300031711 Bacteria 104182
65 Ga0265314_10003885 3300031711 Bacteria 14218
66 Ga0265342_10001477 3300031712 Bacteria 21861
67 Ga0316576_10179014 3300031727 Bacteria 1599
68 Ga0316576_10195481 3300031727 Bacteria 1524
69 Ga0316576_10197319 3300031727 Bacteria 1516
70 Ga0316578_10261466 3300031728 Bacteria 1037
71 Ga0316577_10036454 3300031733 Bacteria 2750
72 Ga0316583_10027177 3300032133 Bacteria 2042
73 Ga0316580_10001398 3300032139 Bacteria 6299
74 Ga0316588_1016535 3300033528 Bacteria 1636
75 Ga0316574_0061637 3300035398 Bacteria 2355
76 Ga0316574_0306163 3300035398 Bacteria 1010
77 Ga0316582_0019802 3300036647 Bacteria 3945
78 Ga0316584_0006231 3300036712 Bacteria 8078
79 Ga0373925_0001540 3300037068 Bacteria 19644
80 Ga0395901_0587320 3300038443 Bacteria 1125
81 Ga0436365_1679456 3300039437 Bacteria 2643
82 Ga0451577_0000046 3300042876 Bacteria 320581
83 Ga0451577_0052125 3300042876 Bacteria 3653
84 Ga0453684_0000178 3300044712 Bacteria 282502
85 Ga0453684_0002527 3300044712 Bacteria 44065
86 Ga0453684_0003910 3300044712 Bacteria 32732
87 Ga0451576_0069525 3300045051 Bacteria 3664
88 Ga0495580_0001807 3300046472 Bacteria 18816
89 Ga0495643_0023883 3300046522 Bacteria 3471
90 Ga0495635_0128705 3300046663 Bacteria 1726
91 Ga0495674_0009656 3300047319 Bacteria 9163
92 Ga0495680_0078287 3300047322 Unclassified 2502
93 Ga0496116_0004564 3300048919 Bacteria 13136
94 Ga0496117_0001946 3300048920 Bacteria 27570
95 Ga0496118_0002139 3300048921 Bacteria 27570
96 Ga0496119_0001456 3300048922 Bacteria 28395
97 Ga0496119_0001783 3300048922 Bacteria 25096
98 Ga0496119_0020065 3300048922 Bacteria 4889
99 Ga0496120_0001503 3300048923 Bacteria 27570
100 Ga0496120_0001910 3300048923 Bacteria 23058
101 Ga0496120_0002666 3300048923 Bacteria 17588
102 Ga0496121_0001880 3300048924 Bacteria 33717
103 Ga0496121_0002417 3300048924 Bacteria 28613
104 Ga0496124_0002078 3300048927 Bacteria 27071
105 Ga0496125_0001944 3300048928 Bacteria 28218
106 Ga0496126_0034241 3300048929 Bacteria 4772
107 Ga0496126_0037340 3300048929 Bacteria 4535
108 Ga0501034_0880872 3300049571 Bacteria 784
109 Ga0501036_0121375 3300049572 Bacteria 2207
110 Ga0501039_0422988 3300049575 Bacteria 1046
111 Ga0501042_0234927 3300049578 Bacteria 1323
112 Ga0501043_0157784 3300049579 Bacteria 1774
113 Ga0501070_0005060 3300049586 Bacteria 11234
114 Ga0501071_0035135 3300049587 Bacteria 3570
115 Ga0501072_0030773 3300049588 Bacteria 4199
116 Ga0501075_0059749 3300049591 Bacteria 2872
117 Ga0501076_0190468 3300049592 Bacteria 1673
118 Ga0501079_0339738 3300049741 Bacteria 1176
119 Ga0501081_0056967 3300049743 Bacteria 2702
120 nmdc:mga07m45_86865_c1 3300050496 Bacteria 1789
121 nmdc:mga05p37_545049_c1 3300050507 Bacteria 1322
122 nmdc:mga06r32_309487_c1 3300050510 Bacteria 1565
123 nmdc:mga08y16_232683_c1 3300050511 Bacteria 1906
124 nmdc:mga08y16_301326_c1 3300050511 Bacteria 1652
125 nmdc:mga0a205_168565_c1 3300050515 Bacteria 2085
126 Ga0500568_0008537 3300053139 Bacteria 4931
127 Ga0500590_139840 3300053148 Unclassified 1108
128 Ga0500622_0001786 3300053156 Bacteria 16428
129 Ga0501084_0094047 3300054114 Bacteria 2517
130 2513858785 2513237137 Bacteria 9558895
131 2676496971 2675903060 Bacteria 10051191
132 2844320775 2844315083 Bacteria 8138177
133 2894238551 2894232714 Bacteria 8834183
134 2902336695 2902330777 Bacteria 6395352
135 2903756300 2903748898 Bacteria 9972761
136 2924720666 2924718760 Bacteria 6331356
137 2935925154 2935916978 Bacteria 9113783
138 8004696973 8004695233 Bacteria 6731676
139 Ga0500616_0204382
140 rootH1_10009044
141 rootL2_10124354
142 rootL2_10378268
143 Ga0070690_100334232
144 Ga0070707_100001163
145 Ga0070698_100001184
146 Ga0070698_100001332
147 Ga0070699_100000304
148 Ga0070697_100014202
149 Ga0070695_100008150
150 Ga0070665_100079446
151 Ga0068856_101527618
152 Ga0068863_100241251
153 Ga0068858_100000019
154 Ga0075431_100366718
155 Ga0075433_10108946
156 Ga0099794_10042230
157 Ga0105240_10000993
158 Ga0105240_10941027
159 Ga0111539_10063187
160 Ga0111539_10252507
161 Ga0105245_10050545
162 Ga0114129_10196808
163 Ga0114129_10297463
164 Ga0105237_10002037
165 Ga0105239_10330082
166 Ga0157370_10003523
167 Ga0157375_10852292
168 Ga0157379_10000335
169 Ga0214544_1000879
170 Ga0214542_1000838
171 Ga0214545_1000599
172 Ga0214543_1000692
173 Ga0228710_1002682
174 Ga0207695_10001475
175 Ga0207671_10001652
176 Ga0207646_10002413
177 Ga0207687_10041638
178 Ga0207703_10000036
179 Ga0207641_10324729
180 Ga0268266_10075191
181 Ga0265337_1008032
182 Ga0265319_1007831
183 Ga0265318_10000483
184 Ga0265323_10063540
185 Ga0265338_10069518
186 Ga0265330_10002880
187 Ga0265330_10006921
188 Ga0265332_10031128
189 Ga0265320_10005888
190 Ga0265320_10022304
191 Ga0265325_10004524
192 Ga0265329_10005386
193 Ga0265340_10000778
194 Ga0265339_10008429
195 Ga0265339_10069064
196 Ga0265331_10009465
197 Ga0265331_10129191
198 Ga0265316_10006345
199 Ga0265313_10216869
200 Ga0316575_10024575
201 Ga0316579_10017247
202 Ga0265314_10000150
203 Ga0265314_10003885
204 Ga0265342_10001477
205 Ga0316576_10179014
206 Ga0316576_10195481
207 Ga0316576_10197319
208 Ga0316578_10261466
209 Ga0316577_10036454
210 Ga0316583_10027177
211 Ga0316580_10001398
212 Ga0316588_1016535
213 Ga0316574_0061637
214 Ga0316574_0306163
215 Ga0316582_0019802
216 Ga0316584_0006231
217 Ga0373925_0001540
218 Ga0395901_0587320
219 Ga0436365_1679456
220 Ga0451577_0000046
221 Ga0451577_0052125
222 Ga0453684_0000178
223 Ga0453684_0002527
224 Ga0453684_0003910
225 Ga0451576_0069525
226 Ga0495580_0001807
227 Ga0495643_0023883
228 Ga0495635_0128705
229 Ga0495674_0009656
230 Ga0495680_0078287
231 Ga0496116_0004564
232 Ga0496117_0001946
233 Ga0496118_0002139
234 Ga0496119_0001456
235 Ga0496119_0001783
236 Ga0496119_0020065
237 Ga0496120_0001503
238 Ga0496120_0001910
239 Ga0496120_0002666
240 Ga0496121_0001880
241 Ga0496121_0002417
242 Ga0496124_0002078
243 Ga0496125_0001944
244 Ga0496126_0034241
245 Ga0496126_0037340
246 Ga0501034_0880872
247 Ga0501036_0121375
248 Ga0501039_0422988
249 Ga0501042_0234927
250 Ga0501043_0157784
251 Ga0501070_0005060
252 Ga0501071_0035135
253 Ga0501072_0030773
254 Ga0501075_0059749
255 Ga0501076_0190468
256 Ga0501079_0339738
257 Ga0501081_0056967
258 nmdc:mga07m45_86865_c1
259 nmdc:mga05p37_545049_c1
260 nmdc:mga06r32_309487_c1
261 nmdc:mga08y16_232683_c1
262 nmdc:mga08y16_301326_c1
263 nmdc:mga0a205_168565_c1
264 Ga0500568_0008537
265 Ga0500590_139840
266 Ga0500622_0001786
267 Ga0501084_0094047
268 2513858785
269 2676496971
270 2844320775
271 2894238551
272 2902336695
273 2903756300
274 2924720666
275 2935925154
276 8004696973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08747

BrxB

BREX protein BrxB

72

197

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zua-assembly1.cif.gz_A crystal structure of mers-cov macro domain in complex with atp 0.6538 112 166
6meb-assembly2.cif.gz_B crystal structure of tylonycteris bat coronavirus hku4 macrodomain in complex with nicotinamide adenine dinucleotide (nad+) 0.6178 107 163
7c33-assembly4.cif.gz_D macro domain of sars-cov-2 in complex with adp-ribose 0.5992 107 163
2fav-assembly2.cif.gz_B crystal structure of sars macro domain in complex with adp-ribose at 1.8 a resolution 0.5921 107 163
6z72-assembly1.cif.gz_A sars-cov-2 macrodomain in complex with adp-hpm 0.5872 103 163
ID Description Score Start End Superfamily
5hihA00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.6485 110 167 3.40.220.10
2favC00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.594 107 163 3.40.220.10
af_A0A0P0XSH7_164_308_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5677 1 169 3.40.50.300
af_Q96EK9_1_110_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5556 33 163 3.40.50.300
af_Q53PN3_164_293_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5551 6 163 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A529HLB7-F1-model_v4 DUF1788 domain-containing protein 0.9494 1 154
AF-A0A529HLB7-F1-model_v4 DUF1788 domain-containing protein 0.9434 1 154
AF-A0A1I0LV43-F1-model_v4 DUF1788 domain-containing protein 0.8956 1 191
AF-A0A1I0LV43-F1-model_v4 DUF1788 domain-containing protein 0.891 1 191
AF-A0A1C3NW23-F1-model_v4 Cytoplasmic protein 0.8909 1 191

Map