F172608

General Info

Members Datasets Scaffolds Average Seq Length
138 115 137 221

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100000459|Ga0068860_10000045914
Length 242
Sequence MNRIIFVITCRLRIWPTASKFPAVLQKPPSLTVNEIYTSIQGESTWAGLRCVFVRLTACDLRCTYCDTEYAFYEGKKRPLQEVIDEVLAIDCPLVELTGGEPLLQKNALPLMTALCDAGRTVLIETSGAHDISKIDPRVHRIMDLKTPGSGECARNLYSNIGHLTKLDEVKFVISSRQDYEWSREQVAKFSLGTRCGTVLFSPVFGKIQPVEIVDWILEDKLDVRFQLQMHKFIWEPAARGV

Samples

Sample ID Description Type Environment
1 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
60 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
64 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
65 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
66 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
67 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
68 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
81 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
82 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
112 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
115 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0
Rhizoplane 0.72
Rhizosphere 82.61
Stem 0
Stem Tuber 0
Unclassified 12.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10001430 3300001991 Bacteria 3298
2 rootH2_10052531 3300003320 Bacteria 8422
3 rootL2_10033589 3300003322 Bacteria 30786
4 rootL2_10235488 3300003322 Unclassified 1446
5 Ga0065704_10333624 3300005289 Unclassified 834
6 Ga0065707_10030479 3300005295 Unclassified 1539
7 Ga0070689_100041360 3300005340 Bacteria 3538
8 Ga0070668_100090636 3300005347 Bacteria 2409
9 Ga0070714_100000196 3300005435 Bacteria 49140
10 Ga0070706_100115223 3300005467 Unclassified 2503
11 Ga0070698_100009656 3300005471 Bacteria 10321
12 Ga0070697_100472647 3300005536 Bacteria 1094
13 Ga0070665_100000005 3300005548 Bacteria 734905
14 Ga0068856_100043229 3300005614 Bacteria 4433
15 Ga0068852_100564736 3300005616 Bacteria 1139
16 Ga0068864_100702297 3300005618 Bacteria 988
17 Ga0068863_100001686 3300005841 Bacteria 21869
18 Ga0068858_100002161 3300005842 Bacteria 19942
19 Ga0068860_100000459 3300005843 Bacteria 51043
20 Ga0068862_100222324 3300005844 Bacteria 1710
21 Ga0081538_10082388 3300005981 Unclassified 1706
22 Ga0081540_1029691 3300005983 Unclassified 3041
23 Ga0075367_10028812 3300006178 Bacteria 3171
24 Ga0075366_10376850 3300006195 Unclassified 872
25 Ga0075428_100778878 3300006844 Bacteria 1017
26 Ga0075429_100937932 3300006880 Bacteria 757
27 Ga0105250_10000005 3300009092 Bacteria 422580
28 Ga0105240_10006551 3300009093 Bacteria 17102
29 Ga0105240_10034421 3300009093 Bacteria 6533
30 Ga0111539_10324660 3300009094 Bacteria 1791
31 Ga0114129_10053889 3300009147 Bacteria 5641
32 Ga0105237_10044746 3300009545 Bacteria 4456
33 Ga0105238_10088335 3300009551 Bacteria 3086
34 Ga0157378_10238431 3300013297 Bacteria 1737
35 Ga0157379_10002097 3300014968 Bacteria 16539
36 Ga0213876_10015586 3300021384 Bacteria 4022
37 Ga0209050_1000576 3300025298 Bacteria 59529
38 Ga0207697_10003045 3300025315 Bacteria 8408
39 Ga0207697_10206715 3300025315 Bacteria 864
40 Ga0207696_1000883 3300025711 Bacteria 18685
41 Ga0207688_10026403 3300025901 Bacteria 3193
42 Ga0207695_10017797 3300025913 Bacteria 8245
43 Ga0207695_10178149 3300025913 Unclassified 2047
44 Ga0207695_10402426 3300025913 Bacteria 1253
45 Ga0207671_10056896 3300025914 Bacteria 2898
46 Ga0207664_10000075 3300025929 Bacteria 102649
47 Ga0207644_10280739 3300025931 Bacteria 1337
48 Ga0207670_10280859 3300025936 Bacteria 1298
49 Ga0207712_10293225 3300025961 Bacteria 1332
50 Ga0207668_10078227 3300025972 Bacteria 2388
51 Ga0207703_10001670 3300026035 Bacteria 19946
52 Ga0207702_10478978 3300026078 Bacteria 1211
53 Ga0207641_10004774 3300026088 Bacteria 11690
54 Ga0207698_10554605 3300026142 Bacteria 1127
55 Ga0209974_10074127 3300027876 Bacteria 1164
56 Ga0268266_10000012 3300028379 Bacteria 734912
57 Ga0268264_10000696 3300028381 Bacteria 39093
58 Ga0307511_10000007 3300030521 Bacteria 167546
59 Ga0265320_10094912 3300031240 Bacteria 1379
60 Ga0265316_10075443 3300031344 Bacteria 2593
61 Ga0265316_10349033 3300031344 Bacteria 1071
62 Ga0316576_10114732 3300031727 Bacteria 2021
63 Ga0316576_10245862 3300031727 Bacteria 1343
64 Ga0316577_10262715 3300031733 Bacteria 976
65 Ga0316583_10006850 3300032133 Bacteria 4104
66 Ga0316574_0013876 3300035398 Bacteria 4642
67 Ga0316574_0070584 3300035398 Bacteria 2206
68 Ga0316582_0193196 3300036647 Unclassified 1387
69 Ga0316582_0236237 3300036647 Bacteria 1251
70 Ga0436365_1361819 3300039437 Bacteria 6240
71 Ga0451791_0624736 3300041451 Bacteria 957
72 Ga0451833_0546189 3300041491 Bacteria 788
73 Ga0451837_1868702 3300041494 Bacteria 1204
74 Ga0451839_0266217 3300041496 Bacteria 1697
75 Ga0451841_0797860 3300041498 Bacteria 1467
76 Ga0451851_0562863 3300041507 Bacteria 1921
77 Ga0451853_3711809 3300041512 Bacteria 1613
78 Ga0451577_0287834 3300042876 Bacteria 1489
79 Ga0451577_0384111 3300042876 Bacteria 1274
80 Ga0466965_0025419 3300044683 Bacteria 2866
81 Ga0466964_0020605 3300044706 Bacteria 2541
82 Ga0453684_0625261 3300044712 Unclassified 1177
83 Ga0466971_0000008 3300044719 Bacteria 108703
84 Ga0466957_0013707 3300044842 Bacteria 4707
85 Ga0451576_0023545 3300045051 Bacteria 6667
86 Ga0451576_1105405 3300045051 Bacteria 829
87 Ga0495643_0000405 3300046522 Bacteria 56402
88 Ga0495680_0123005 3300047322 Bacteria 1914
89 Ga0495680_0148409 3300047322 Unclassified 1711
90 Ga0496118_0189482 3300048921 Bacteria 1232
91 Ga0496121_0223030 3300048924 Bacteria 1326
92 Ga0496124_0001016 3300048927 Bacteria 44491
93 Ga0496125_0000006 3300048928 Bacteria 759385
94 Ga0501031_0002093 3300049568 Bacteria 12575
95 Ga0501032_0073672 3300049569 Bacteria 2275
96 Ga0501033_0000187 3300049570 Bacteria 59491
97 Ga0501034_0000149 3300049571 Bacteria 131917
98 Ga0501036_0005189 3300049572 Bacteria 10534
99 Ga0501036_0150675 3300049572 Bacteria 1962
100 Ga0501036_0452115 3300049572 Bacteria 1070
101 Ga0501036_0813007 3300049572 Unclassified 769
102 Ga0501037_0000080 3300049573 Bacteria 87262
103 Ga0501038_0046526 3300049574 Bacteria 3762
104 Ga0501038_0094789 3300049574 Bacteria 2495
105 Ga0501039_0013978 3300049575 Bacteria 6142
106 Ga0501040_0076194 3300049576 Bacteria 2319
107 Ga0501041_0240883 3300049577 Bacteria 1137
108 Ga0501042_0142152 3300049578 Bacteria 1730
109 Ga0501042_0266089 3300049578 Bacteria 1238
110 Ga0501043_0005983 3300049579 Bacteria 9777
111 Ga0501043_0032726 3300049579 Bacteria 4088
112 Ga0501047_0015349 3300049581 Bacteria 7297
113 Ga0501048_0018121 3300049582 Bacteria 5181
114 Ga0501068_0281880 3300049584 Bacteria 1062
115 Ga0501069_0497480 3300049585 Unclassified 727
116 Ga0501070_0021153 3300049586 Bacteria 5460
117 Ga0501070_0364982 3300049586 Bacteria 1171
118 Ga0501075_0021614 3300049591 Bacteria 4692
119 Ga0501076_0011124 3300049592 Bacteria 6696
120 Ga0501077_0102273 3300049593 Bacteria 1816
121 Ga0501079_0055942 3300049741 Bacteria 3044
122 Ga0501079_0056696 3300049741 Bacteria 3023
123 Ga0501081_0021486 3300049743 Bacteria 4308
124 Ga0501081_0740715 3300049743 Unclassified 738
125 Ga0501035_0000001 3300049822 Bacteria 1037138
126 Ga0501035_0156769 3300049822 Bacteria 1973
127 Ga0501044_0003710 3300049823 Bacteria 17153
128 Ga0501045_0104703 3300049824 Bacteria 2096
129 Ga0501045_0382325 3300049824 Unclassified 1048
130 nmdc:mga05p37_366073_c1 3300050507 Unclassified 1693
131 nmdc:mga0a205_73451_c1 3300050515 Bacteria 3304
132 Ga0500555_000008 3300053103 Bacteria 282333
133 Ga0500616_0017574 3300053153 Bacteria 4057
134 Ga0500645_039890 3300053730 Bacteria 1390
135 Ga0501082_0099077 3300060353 Bacteria 2520
136 Ga0466962_0000004 3300061719 Bacteria 179133
137 Ga0530510_0111305 3300061734 Bacteria 2006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10235488 rootL2_102354882 195
2 3300049741 Ga0501079_0056696 Ga0501079_0056696_1532_2137 201
3 3300036647 Ga0316582_0193196 Ga0316582_0193196_458_1096 205
4 3300049824 Ga0501045_0382325 Ga0501045_0382325_69_815 205
5 3300049577 Ga0501041_0240883 Ga0501041_0240883_374_1120 206
6 3300049584 Ga0501068_0281880 Ga0501068_0281880_207_953 206
7 3300049572 Ga0501036_0813007 Ga0501036_0813007_61_690 209
8 3300049743 Ga0501081_0740715 Ga0501081_0740715_36_665 209
9 3300049574 Ga0501038_0094789 Ga0501038_0094789_1637_2275 210
10 3300006178 Ga0075367_10028812 Ga0075367_100288123 211
11 3300035398 Ga0316574_0013876 Ga0316574_0013876_3686_4321 211
12 3300049571 Ga0501034_0000149 Ga0501034_0000149_28278_28913 211
13 3300049572 Ga0501036_0150675 Ga0501036_0150675_693_1328 211
14 3300005536 Ga0070697_100472647 Ga0070697_1004726471 212
15 3300006880 Ga0075429_100937932 Ga0075429_1009379321 212
16 3300009092 Ga0105250_10000005 Ga0105250_1000000557 212
17 3300009094 Ga0111539_10324660 Ga0111539_103246602 212
18 3300009147 Ga0114129_10053889 Ga0114129_100538891 212
19 3300014968 Ga0157379_10002097 Ga0157379_1000209712 212
20 3300025711 Ga0207696_1000883 Ga0207696_10008834 212
21 3300027876 Ga0209974_10074127 Ga0209974_100741271 212
22 3300031240 Ga0265320_10094912 Ga0265320_100949122 212
23 3300031727 Ga0316576_10114732 Ga0316576_101147322 212
24 3300031727 Ga0316576_10245862 Ga0316576_102458622 212
25 3300031733 Ga0316577_10262715 Ga0316577_102627151 212
26 3300032133 Ga0316583_10006850 Ga0316583_100068506 212
27 3300035398 Ga0316574_0070584 Ga0316574_0070584_1529_2167 212
28 3300036647 Ga0316582_0236237 Ga0316582_0236237_259_897 212
29 3300041451 Ga0451791_0624736 Ga0451791_0624736_255_935 212
30 3300041491 Ga0451833_0546189 Ga0451833_0546189_89_778 212
31 3300041494 Ga0451837_1868702 Ga0451837_1868702_48_728 212
32 3300041496 Ga0451839_0266217 Ga0451839_0266217_147_836 212
33 3300041498 Ga0451841_0797860 Ga0451841_0797860_118_807 212
34 3300041507 Ga0451851_0562863 Ga0451851_0562863_130_819 212
35 3300041512 Ga0451853_3711809 Ga0451853_3711809_43_732 212
36 3300047322 Ga0495680_0123005 Ga0495680_0123005_1096_1737 212
37 3300047322 Ga0495680_0148409 Ga0495680_0148409_1008_1649 212
38 3300048927 Ga0496124_0001016 Ga0496124_0001016_7779_8519 212
39 3300050507 nmdc:mga05p37_366073_c1 nmdc:mga05p37_366073_c1_141_833 212
40 3300050515 nmdc:mga0a205_73451_c1 nmdc:mga0a205_73451_c1_1504_2142 212
41 3300005981 Ga0081538_10082388 Ga0081538_100823881 213
42 3300025913 Ga0207695_10178149 Ga0207695_101781493 213
43 3300031344 Ga0265316_10349033 Ga0265316_103490331 213
44 3300042876 Ga0451577_0287834 Ga0451577_0287834_579_1223 213
45 3300042876 Ga0451577_0384111 Ga0451577_0384111_143_814 213
46 3300044712 Ga0453684_0625261 Ga0453684_0625261_18_662 213
47 3300045051 Ga0451576_0023545 Ga0451576_0023545_5279_5950 213
48 3300045051 Ga0451576_1105405 Ga0451576_1105405_54_698 213
49 3300049572 Ga0501036_0452115 Ga0501036_0452115_414_1055 213
50 3300049576 Ga0501040_0076194 Ga0501040_0076194_1507_2148 213
51 3300049578 Ga0501042_0142152 Ga0501042_0142152_973_1614 213
52 3300049578 Ga0501042_0266089 Ga0501042_0266089_111_788 213
53 3300049582 Ga0501048_0018121 Ga0501048_0018121_2648_3289 213
54 3300049586 Ga0501070_0364982 Ga0501070_0364982_17_658 213
55 3300049591 Ga0501075_0021614 Ga0501075_0021614_2546_3187 213
56 3300049592 Ga0501076_0011124 Ga0501076_0011124_1889_2530 213
57 3300049593 Ga0501077_0102273 Ga0501077_0102273_744_1385 213
58 3300049741 Ga0501079_0055942 Ga0501079_0055942_1945_2586 213
59 3300049743 Ga0501081_0021486 Ga0501081_0021486_2083_2724 213
60 3300049822 Ga0501035_0156769 Ga0501035_0156769_1012_1653 213
61 3300049824 Ga0501045_0104703 Ga0501045_0104703_1351_1992 213
62 3300060353 Ga0501082_0099077 Ga0501082_0099077_1077_1718 213
63 3300061734 Ga0530510_0111305 Ga0530510_0111305_880_1578 213
64 3300001991 JGI24743J22301_10001430 JGI24743J22301_100014305 214
65 3300003320 rootH2_10052531 rootH2_100525312 214
66 3300003322 rootL2_10033589 rootL2_1003358918 214
67 3300005289 Ga0065704_10333624 Ga0065704_103336241 214
68 3300005295 Ga0065707_10030479 Ga0065707_100304793 214
69 3300005340 Ga0070689_100041360 Ga0070689_1000413606 214
70 3300005347 Ga0070668_100090636 Ga0070668_1000906363 214
71 3300005435 Ga0070714_100000196 Ga0070714_1000001967 214
72 3300005467 Ga0070706_100115223 Ga0070706_1001152234 214
73 3300005471 Ga0070698_100009656 Ga0070698_1000096567 214
74 3300005548 Ga0070665_100000005 Ga0070665_10000000578 214
75 3300005614 Ga0068856_100043229 Ga0068856_1000432294 214
76 3300005616 Ga0068852_100564736 Ga0068852_1005647362 214
77 3300005618 Ga0068864_100702297 Ga0068864_1007022971 214
78 3300005841 Ga0068863_100001686 Ga0068863_1000016863 214
79 3300005842 Ga0068858_100002161 Ga0068858_10000216112 214
80 3300005843 Ga0068860_100000459 Ga0068860_10000045914 214
81 3300005844 Ga0068862_100222324 Ga0068862_1002223242 214
82 3300005983 Ga0081540_1029691 Ga0081540_10296912 214
83 3300006195 Ga0075366_10376850 Ga0075366_103768502 214
84 3300006844 Ga0075428_100778878 Ga0075428_1007788781 214
85 3300009093 Ga0105240_10006551 Ga0105240_1000655116 214
86 3300009093 Ga0105240_10034421 Ga0105240_100344214 214
87 3300009545 Ga0105237_10044746 Ga0105237_100447464 214
88 3300009551 Ga0105238_10088335 Ga0105238_100883352 214
89 3300013297 Ga0157378_10238431 Ga0157378_102384313 214
90 3300021384 Ga0213876_10015586 Ga0213876_100155862 214
91 3300025298 Ga0209050_1000576 Ga0209050_10005767 214
92 3300025315 Ga0207697_10003045 Ga0207697_100030457 214
93 3300025315 Ga0207697_10206715 Ga0207697_102067151 214
94 3300025901 Ga0207688_10026403 Ga0207688_100264035 214
95 3300025913 Ga0207695_10017797 Ga0207695_100177973 214
96 3300025913 Ga0207695_10402426 Ga0207695_104024261 214
97 3300025914 Ga0207671_10056896 Ga0207671_100568963 214
98 3300025929 Ga0207664_10000075 Ga0207664_1000007597 214
99 3300025931 Ga0207644_10280739 Ga0207644_102807391 214
100 3300025936 Ga0207670_10280859 Ga0207670_102808592 214
101 3300025961 Ga0207712_10293225 Ga0207712_102932252 214
102 3300025972 Ga0207668_10078227 Ga0207668_100782272 214
103 3300026035 Ga0207703_10001670 Ga0207703_1000167013 214
104 3300026078 Ga0207702_10478978 Ga0207702_104789782 214
105 3300026088 Ga0207641_10004774 Ga0207641_1000477411 214
106 3300026142 Ga0207698_10554605 Ga0207698_105546052 214
107 3300028379 Ga0268266_10000012 Ga0268266_10000012570 214
108 3300028381 Ga0268264_10000696 Ga0268264_1000069642 214
109 3300030521 Ga0307511_10000007 Ga0307511_10000007117 214
110 3300031344 Ga0265316_10075443 Ga0265316_100754433 214
111 3300039437 Ga0436365_1361819 Ga0436365_1361819_3172_3825 214
112 3300044683 Ga0466965_0025419 Ga0466965_0025419_1263_1907 214
113 3300044706 Ga0466964_0020605 Ga0466964_0020605_1175_1819 214
114 3300044719 Ga0466971_0000008 Ga0466971_0000008_60584_61228 214
115 3300044842 Ga0466957_0013707 Ga0466957_0013707_3114_3758 214
116 3300046522 Ga0495643_0000405 Ga0495643_0000405_39097_39753 214
117 3300048921 Ga0496118_0189482 Ga0496118_0189482_387_1082 214
118 3300048924 Ga0496121_0223030 Ga0496121_0223030_409_1065 214
119 3300048928 Ga0496125_0000006 Ga0496125_0000006_515682_516398 214
120 3300049568 Ga0501031_0002093 Ga0501031_0002093_209_853 214
121 3300049569 Ga0501032_0073672 Ga0501032_0073672_531_1175 214
122 3300049570 Ga0501033_0000187 Ga0501033_0000187_13428_14072 214
123 3300049572 Ga0501036_0005189 Ga0501036_0005189_8357_9001 214
124 3300049573 Ga0501037_0000080 Ga0501037_0000080_18459_19103 214
125 3300049574 Ga0501038_0046526 Ga0501038_0046526_839_1483 214
126 3300049575 Ga0501039_0013978 Ga0501039_0013978_4524_5168 214
127 3300049579 Ga0501043_0005983 Ga0501043_0005983_292_936 214
128 3300049579 Ga0501043_0032726 Ga0501043_0032726_292_936 214
129 3300049581 Ga0501047_0015349 Ga0501047_0015349_813_1457 214
130 3300049585 Ga0501069_0497480 Ga0501069_0497480_52_696 214
131 3300049586 Ga0501070_0021153 Ga0501070_0021153_3084_3728 214
132 3300049822 Ga0501035_0000001 Ga0501035_0000001_129322_129966 214
133 3300049823 Ga0501044_0003710 Ga0501044_0003710_7728_8372 214
134 3300053103 Ga0500555_000008 Ga0500555_000008_261318_261998 214
135 3300053153 Ga0500616_0017574 Ga0500616_0017574_262_942 214
136 3300053730 Ga0500645_039890 Ga0500645_039890_16_678 214
137 3300061719 Ga0466962_0000004 Ga0466962_0000004_47230_47874 214
138 iso_pu_bacteria 2786546548 2787508237 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

54

147

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nhl-assembly1.cif.gz_B-2 crystal structure of quee from escherichia coli 0.8381 1 203
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.8355 1 203
5tgs-assembly1.cif.gz_B crystal structure of quee from bacillus subtilis with methionine bound 0.8348 2 207
5tgs-assembly1.cif.gz_B crystal structure of quee from bacillus subtilis with methionine bound 0.8018 2 207
5tgs-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with methionine bound 0.801 3 207
ID Description Score Start End Superfamily
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8138 3 206 3.20.20.70
af_Q59039_1_242_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8061 5 206 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8048 3 207 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7746 3 206 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7696 3 207 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V6MCN2-F1-model_v4 7-carboxy-7-deazaguanine synthase QueE 0.9963 50 214 GO:0051539
AF-A0A7Y1SHN7-F1-model_v4 deleted 0.9963 71 154
AF-A0A7W0LCA8-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9937 67 214 GO:0051539
AF-A0A2V5MAR6-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9935 54 214 GO:0051539
AF-A0A2V6KKF6-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9932 45 214 GO:0016829
GO:0051539

Feature Viewer

pLDDT pTM Quality
94.35 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map