F171752

General Info

Members Datasets Scaffolds Average Seq Length
138 101 276 355

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10064442|rootL2_100644421
Length 377
Sequence MMNVLFLFPYPLNESPSQRFRFEQYLGIIEHSGISCQTQSFWSIATWQILYKQGFLLRKILGFAGGMCRRMWALVKASRADFVFIHRECAPVGPPFFEWIIANVLRKKIIYDFDDAIWLPNTSDENKLAALVKWHGKVADICRWSYKVSCGNQYLADYARQFNANVVVNPTTIDTNALHNPALYPTPSHTGKVVIGWTGTHSTLKYIDPVVPVLQKLESLYPETFEFMVIANRKPDLPLRNVTFIPWTKHSEIPDLLRFDIGIMPLTDDIWAKGKCGFNALQYMALGIPAIVSPVGVNTEIVDSKVNGFVADSETEWLDAIIFLIDHADERRRMGNAGRKKIEQHYSVASNSSTVRSLFLQNERTKASPKKGSNGIL

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
93 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
96 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
97 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
98 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
99 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
100 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
101 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.97
Nodule 0
Rhizoplane 0
Rhizosphere 84.06
Stem 0
Stem Tuber 0
Unclassified 7.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10064442 3300003322 Unclassified 1820
2 MBSR1b_contig_4202337 2162886012 Bacteria 2374
3 JGI24736J21556_1000180 3300001904 Bacteria 11307
4 JGI24737J22298_10000451 3300001990 Bacteria 14121
5 JGI24735J21928_10013742 3300002067 Bacteria 2539
6 JGI25157J39369_1007401 3300002741 Bacteria 1586
7 rootL2_10061352 3300003322 Bacteria 4013
8 rootL2_10261068 3300003322 Bacteria 1685
9 rootL2_10306376 3300003322 Bacteria 4479
10 rootH1_10005883 3300003323 Bacteria 24640
11 Ga0055531_10000567 3300003794 Bacteria 32412
12 Ga0065165_1000797 3300005262 Bacteria 42099
13 Ga0065712_10000750 3300005290 Bacteria 12148
14 Ga0065712_10093744 3300005290 Bacteria 2258
15 Ga0065715_10000595 3300005293 Bacteria 9966
16 Ga0065707_10119815 3300005295 Bacteria 2142
17 Ga0070689_100065762 3300005340 Bacteria 2824
18 Ga0070689_100121983 3300005340 Bacteria 2082
19 Ga0070669_100092925 3300005353 Unclassified 2265
20 Ga0070675_100022208 3300005354 Bacteria 5068
21 Ga0070673_100107884 3300005364 Bacteria 2304
22 Ga0070688_100018653 3300005365 Bacteria 4007
23 Ga0070688_100027913 3300005365 Bacteria 3364
24 Ga0070659_100018670 3300005366 Bacteria 5235
25 Ga0070659_100156849 3300005366 Bacteria 1859
26 Ga0070700_100029078 3300005441 Bacteria 3292
27 Ga0070678_100190960 3300005456 Bacteria 1684
28 Ga0070685_10027162 3300005466 Bacteria 3162
29 Ga0070698_100000890 3300005471 Bacteria 32821
30 Ga0070698_100018515 3300005471 Bacteria 7333
31 Ga0070698_100119019 3300005471 Bacteria 2602
32 Ga0070672_100128949 3300005543 Bacteria 2077
33 Ga0070696_100304623 3300005546 Bacteria 1221
34 Ga0070665_100234338 3300005548 Bacteria 1836
35 Ga0068855_100200854 3300005563 Unclassified 2244
36 Ga0068857_100090451 3300005577 Unclassified 2739
37 Ga0068857_100230361 3300005577 Bacteria 1694
38 Ga0068857_100286427 3300005577 Bacteria 1516
39 Ga0068861_100004189 3300005719 Bacteria 9670
40 Ga0068851_10104750 3300005834 Unclassified 1504
41 Ga0068862_100039306 3300005844 Bacteria 4018
42 Ga0097621_100001635 3300006237 Bacteria 15353
43 Ga0097621_100006653 3300006237 Bacteria 8214
44 Ga0068871_100008788 3300006358 Bacteria 7274
45 Ga0075428_100022010 3300006844 Bacteria 7057
46 Ga0075428_100076850 3300006844 Bacteria 3645
47 Ga0075428_100230986 3300006844 Bacteria 1996
48 Ga0075431_100010239 3300006847 Bacteria 9426
49 Ga0075429_100002016 3300006880 Bacteria 16882
50 Ga0111539_10046248 3300009094 Bacteria 5206
51 Ga0111539_10047677 3300009094 Bacteria 5120
52 Ga0105247_10230435 3300009101 Unclassified 1257
53 Ga0114129_10267870 3300009147 Bacteria 2286
54 Ga0105242_10003421 3300009176 Bacteria 12339
55 Ga0105249_10017274 3300009553 Bacteria 6405
56 Ga0105249_10242479 3300009553 Bacteria 1783
57 Ga0105246_10164560 3300011119 Bacteria 1693
58 Ga0157373_10001743 3300013100 Bacteria 16548
59 Ga0157371_10000257 3300013102 Bacteria 73583
60 Ga0157370_10036515 3300013104 Bacteria 4768
61 Ga0157369_10056117 3300013105 Bacteria 4250
62 Ga0157378_10013527 3300013297 Bacteria 7137
63 Ga0163162_10005891 3300013306 Bacteria 11856
64 Ga0163162_10009660 3300013306 Bacteria 9382
65 Ga0163162_10064760 3300013306 Bacteria 3700
66 Ga0163162_10491471 3300013306 Bacteria 1358
67 Ga0157372_10000327 3300013307 Bacteria 52004
68 Ga0157375_10016722 3300013308 Bacteria 6600
69 Ga0163163_10221007 3300014325 Unclassified 1943
70 Ga0157380_10026467 3300014326 Bacteria 4404
71 Ga0157380_10056302 3300014326 Bacteria 3126
72 Ga0157380_10137768 3300014326 Bacteria 2092
73 Ga0157377_10020430 3300014745 Bacteria 3470
74 Ga0157376_10021021 3300014969 Bacteria 5063
75 Ga0163161_10018488 3300017792 Bacteria 4883
76 Ga0209026_1000348 3300025250 Bacteria 44090
77 Ga0209233_1001328 3300025261 Bacteria 9869
78 Ga0209050_1007823 3300025298 Bacteria 5877
79 Ga0209050_1011024 3300025298 Bacteria 4356
80 Ga0209257_1000023 3300025304 Bacteria 753019
81 Ga0207656_10077768 3300025321 Unclassified 1486
82 Ga0207647_10000041 3300025904 Bacteria 92367
83 Ga0207643_10011964 3300025908 Bacteria 4685
84 Ga0207681_10058756 3300025923 Bacteria 2634
85 Ga0207659_10006672 3300025926 Bacteria 7092
86 Ga0207690_10067421 3300025932 Unclassified 2455
87 Ga0207690_10127198 3300025932 Bacteria 1859
88 Ga0207686_10001372 3300025934 Bacteria 13823
89 Ga0207686_10001455 3300025934 Bacteria 13421
90 Ga0207670_10007150 3300025936 Bacteria 6220
91 Ga0207670_10070111 3300025936 Bacteria 2420
92 Ga0207691_10151193 3300025940 Bacteria 2041
93 Ga0207689_10012196 3300025942 Bacteria 7352
94 Ga0207712_10001286 3300025961 Bacteria 17249
95 Ga0207708_10048610 3300026075 Bacteria 3229
96 Ga0207708_10157655 3300026075 Bacteria 1791
97 Ga0207641_10000111 3300026088 Bacteria 120527
98 Ga0207641_10005059 3300026088 Bacteria 11299
99 Ga0207648_10072980 3300026089 Bacteria 2991
100 Ga0207676_10144056 3300026095 Bacteria 2044
101 Ga0207676_10429103 3300026095 Bacteria 1241
102 Ga0207674_10247377 3300026116 Bacteria 1730
103 Ga0207674_10256512 3300026116 Bacteria 1695
104 Ga0207675_100010995 3300026118 Bacteria 8479
105 Ga0207683_10486820 3300026121 Bacteria 1139
106 Ga0207428_10201519 3300027907 Bacteria 1497
107 Ga0268265_10038102 3300028380 Bacteria 3534
108 Ga0268265_10089760 3300028380 Bacteria 2453
109 Ga0268264_10194036 3300028381 Bacteria 1853
110 Ga0265327_10005237 3300031251 Bacteria 10936
111 Ga0265327_10031382 3300031251 Bacteria 2986
112 Ga0307513_10059022 3300031456 Bacteria 4074
113 Ga0307509_10023593 3300031507 Bacteria 6902
114 Ga0307408_100000323 3300031548 Bacteria 45826
115 Ga0307408_100146870 3300031548 Bacteria 1857
116 Ga0307416_100010324 3300032002 Bacteria 6163
117 Ga0307414_10177438 3300032004 Bacteria 1710
118 Ga0307415_100007758 3300032126 Bacteria 5896
119 Ga0395899_0000111 3300037312 Bacteria 138935
120 Ga0395901_0000987 3300038443 Bacteria 30708
121 Ga0395901_0128584 3300038443 Bacteria 2663
122 Ga0451576_0024785 3300045051 Bacteria 6474
123 Ga0495638_0000001 3300046460 Bacteria 1114121
124 Ga0501040_0299224 3300049576 Bacteria 1150
125 Ga0501247_000776 3300049677 Bacteria 2771
126 nmdc:mga09592_35430_c1 3300050508 Bacteria 4178
127 nmdc:mga08y16_3286_c1 3300050511 Bacteria 16755
128 nmdc:mga08y16_57576_c1 3300050511 Unclassified 4061
129 nmdc:mga08y16_95700_c1 3300050511 Unclassified 3093
130 Ga0500604_0000921 3300053151 Bacteria 8129
131 Ga0500616_0000009 3300053153 Bacteria 779095
132 Ga0500622_0000009 3300053156 Bacteria 419980
133 Ga0500622_0000016 3300053156 Bacteria 337983
134 Ga0500622_0006443 3300053156 Bacteria 6804
135 2740032724 2739367866 Bacteria 4215900
136 2839991859 2839989709 Bacteria 3773432
137 2890804951 2890804823 Bacteria 3717572
138 2910246676 2910245624 Bacteria 6935613
139 rootL2_10064442
140 MBSR1b_contig_4202337
141 JGI24736J21556_1000180
142 JGI24737J22298_10000451
143 JGI24735J21928_10013742
144 JGI25157J39369_1007401
145 rootL2_10061352
146 rootL2_10261068
147 rootL2_10306376
148 rootH1_10005883
149 Ga0055531_10000567
150 Ga0065165_1000797
151 Ga0065712_10000750
152 Ga0065712_10093744
153 Ga0065715_10000595
154 Ga0065707_10119815
155 Ga0070689_100065762
156 Ga0070689_100121983
157 Ga0070669_100092925
158 Ga0070675_100022208
159 Ga0070673_100107884
160 Ga0070688_100018653
161 Ga0070688_100027913
162 Ga0070659_100018670
163 Ga0070659_100156849
164 Ga0070700_100029078
165 Ga0070678_100190960
166 Ga0070685_10027162
167 Ga0070698_100000890
168 Ga0070698_100018515
169 Ga0070698_100119019
170 Ga0070672_100128949
171 Ga0070696_100304623
172 Ga0070665_100234338
173 Ga0068855_100200854
174 Ga0068857_100090451
175 Ga0068857_100230361
176 Ga0068857_100286427
177 Ga0068861_100004189
178 Ga0068851_10104750
179 Ga0068862_100039306
180 Ga0097621_100001635
181 Ga0097621_100006653
182 Ga0068871_100008788
183 Ga0075428_100022010
184 Ga0075428_100076850
185 Ga0075428_100230986
186 Ga0075431_100010239
187 Ga0075429_100002016
188 Ga0111539_10046248
189 Ga0111539_10047677
190 Ga0105247_10230435
191 Ga0114129_10267870
192 Ga0105242_10003421
193 Ga0105249_10017274
194 Ga0105249_10242479
195 Ga0105246_10164560
196 Ga0157373_10001743
197 Ga0157371_10000257
198 Ga0157370_10036515
199 Ga0157369_10056117
200 Ga0157378_10013527
201 Ga0163162_10005891
202 Ga0163162_10009660
203 Ga0163162_10064760
204 Ga0163162_10491471
205 Ga0157372_10000327
206 Ga0157375_10016722
207 Ga0163163_10221007
208 Ga0157380_10026467
209 Ga0157380_10056302
210 Ga0157380_10137768
211 Ga0157377_10020430
212 Ga0157376_10021021
213 Ga0163161_10018488
214 Ga0209026_1000348
215 Ga0209233_1001328
216 Ga0209050_1007823
217 Ga0209050_1011024
218 Ga0209257_1000023
219 Ga0207656_10077768
220 Ga0207647_10000041
221 Ga0207643_10011964
222 Ga0207681_10058756
223 Ga0207659_10006672
224 Ga0207690_10067421
225 Ga0207690_10127198
226 Ga0207686_10001372
227 Ga0207686_10001455
228 Ga0207670_10007150
229 Ga0207670_10070111
230 Ga0207691_10151193
231 Ga0207689_10012196
232 Ga0207712_10001286
233 Ga0207708_10048610
234 Ga0207708_10157655
235 Ga0207641_10000111
236 Ga0207641_10005059
237 Ga0207648_10072980
238 Ga0207676_10144056
239 Ga0207676_10429103
240 Ga0207674_10247377
241 Ga0207674_10256512
242 Ga0207675_100010995
243 Ga0207683_10486820
244 Ga0207428_10201519
245 Ga0268265_10038102
246 Ga0268265_10089760
247 Ga0268264_10194036
248 Ga0265327_10005237
249 Ga0265327_10031382
250 Ga0307513_10059022
251 Ga0307509_10023593
252 Ga0307408_100000323
253 Ga0307408_100146870
254 Ga0307416_100010324
255 Ga0307414_10177438
256 Ga0307415_100007758
257 Ga0395899_0000111
258 Ga0395901_0000987
259 Ga0395901_0128584
260 Ga0451576_0024785
261 Ga0495638_0000001
262 Ga0501040_0299224
263 Ga0501247_000776
264 nmdc:mga09592_35430_c1
265 nmdc:mga08y16_3286_c1
266 nmdc:mga08y16_57576_c1
267 nmdc:mga08y16_95700_c1
268 Ga0500604_0000921
269 Ga0500616_0000009
270 Ga0500622_0000009
271 Ga0500622_0000016
272 Ga0500622_0006443
273 2740032724
274 2839991859
275 2890804951
276 2910246676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

234

341

0.96

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

212

356

0.75

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

192

327

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wac-assembly1.cif.gz_A crystal structure of tarm 0.754 71 357
3mbo-assembly1.cif.gz_B crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.7539 3 356
2bfw-assembly1.cif.gz_A structure of the c domain of glycogen synthase from pyrococcus abyssi 0.7473 191 341
3mbo-assembly1.cif.gz_B crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.7461 3 356
7ec7-assembly1.cif.gz_A crystal structure of sdgb (complexed with phosphate ions) 0.7461 71 356
ID Description Score Start End Superfamily
af_Q9SSP6_536_651_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9123 257 343 3.40.50.2000
af_Q4D163_355_523_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8616 192 338 3.40.50.2000
af_P96407_190_356_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8293 192 339 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8186 196 343 3.40.50.2000
af_A0A1D6NHE4_303_487_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8183 188 356 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A537KN79-F1-model_v4 Glycosyltransferase family 4 protein 0.9852 1 357 GO:0016757
AF-A0A1V5G856-F1-model_v4 Glycosyl transferases group 1 0.9735 139 357 GO:0016757
AF-A0A519Q4W1-F1-model_v4 deleted 0.9731 214 357
AF-A0A4Q3RWZ8-F1-model_v4 Glycosyltransferase 0.9726 3 357 GO:0016740
AF-A0A838F4D4-F1-model_v4 Glycosyltransferase family 4 protein 0.9696 193 354 GO:0016740

Map