F164898

General Info

Members Datasets Scaffolds Average Seq Length
135 120 270 260

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221578|2643897493
Length 289
Sequence PFSSFSTSSSGSLSSTVVALRRAGCVFAEDEARLLHEAAASADELSLLVERRAAGLPLEHVLGWADFHGRRFAVDAGVFVPRRRTEFLVEQAAALAPRRAVVVDLCCGSGALGVALAAASDAAELHACDVEPAAVRCARRNVGDLGQVYEGDLFAPLPTALRGRVDVLLANVPYVPTGDVELLPAEARIHEPRVALDGGGDGLDVMRRVAAEAPQWLAPGGSLLVEASERQRDTAVEVLRAAGLSPRVLVSEELYATVLVGTAPAGAAEHLGFSPWGDPVTAPDPTPHD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
63 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
75 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
78 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
79 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
80 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
84 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
85 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
86 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
94 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
95 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
96 2643221578 Streptomyces sp. Root63 Isolate Unclassified
97 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
98 2643221548 Streptomyces sp. Root55 Isolate Unclassified
99 2643221670 Streptomyces sp. Root431 Isolate Unclassified
100 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
101 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
102 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
103 2818991459 Paenibacillus sp. 597 Isolate Unclassified
104 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
105 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
106 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
107 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
108 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
109 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
110 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
111 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
112 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
113 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
114 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
115 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
116 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
117 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
118 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
119 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
120 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.48
Metatranscriptomes 0
Isolates 18.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 9.63
Rhizosphere 73.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100549110 3300005329 Bacteria 1105
2 Ga0070670_100304271 3300005331 Bacteria 1395
3 Ga0070666_10023423 3300005335 Bacteria 4020
4 Ga0070680_100335207 3300005336 Bacteria 1285
5 Ga0070682_100007472 3300005337 Bacteria 6162
6 Ga0068868_100186161 3300005338 Bacteria 1725
7 Ga0070668_100006122 3300005347 Bacteria 8920
8 Ga0070671_100011859 3300005355 Bacteria 7010
9 Ga0070667_100002062 3300005367 Bacteria 17779
10 Ga0070665_100000362 3300005548 Bacteria 67720
11 Ga0068857_100030577 3300005577 Bacteria 4756
12 Ga0068852_100001272 3300005616 Bacteria 16837
13 Ga0068859_100002497 3300005617 Bacteria 18700
14 Ga0068861_100485563 3300005719 Bacteria 1114
15 Ga0068863_100006721 3300005841 Bacteria 11276
16 Ga0068858_100025772 3300005842 Bacteria 5470
17 Ga0068860_100000035 3300005843 Bacteria 238993
18 Ga0075428_100002554 3300006844 Bacteria 19788
19 Ga0075429_100001358 3300006880 Bacteria 20005
20 Ga0097620_100002497 3300006931 Bacteria 18700
21 Ga0105245_10030380 3300009098 Bacteria 4777
22 Ga0105247_10012052 3300009101 Bacteria 5193
23 Ga0114129_10003492 3300009147 Bacteria 22098
24 Ga0105241_10071061 3300009174 Bacteria 2702
25 Ga0105249_10241271 3300009553 Bacteria 1787
26 Ga0157374_10311340 3300013296 Bacteria 1559
27 Ga0157372_10120496 3300013307 Bacteria 3013
28 Ga0157379_10009147 3300014968 Bacteria 8628
29 Ga0207426_1019254 3300025302 Bacteria 2389
30 Ga0207710_10006082 3300025900 Bacteria 5169
31 Ga0207680_10001726 3300025903 Bacteria 10305
32 Ga0207654_10097914 3300025911 Bacteria 1801
33 Ga0207650_10181145 3300025925 Bacteria 1679
34 Ga0207687_10014753 3300025927 Bacteria 5116
35 Ga0207664_10494805 3300025929 Bacteria 1094
36 Ga0207661_10211991 3300025944 Bacteria 1708
37 Ga0207668_10012405 3300025972 Bacteria 5217
38 Ga0207668_10036842 3300025972 Bacteria 3269
39 Ga0207658_10013834 3300025986 Bacteria 5521
40 Ga0207677_10049973 3300026023 Bacteria 2826
41 Ga0207677_10506342 3300026023 Bacteria 1045
42 Ga0207703_10018654 3300026035 Bacteria 5419
43 Ga0207702_10208795 3300026078 Bacteria 1814
44 Ga0207641_10003666 3300026088 Bacteria 13527
45 Ga0207674_10062558 3300026116 Bacteria 3760
46 Ga0207674_10352866 3300026116 Bacteria 1422
47 Ga0207675_100647217 3300026118 Bacteria 1063
48 Ga0207698_10003187 3300026142 Bacteria 9844
49 Ga0268266_10008736 3300028379 Bacteria 8979
50 Ga0268264_10000031 3300028381 Bacteria 409525
51 Ga0307515_10060644 3300028794 Bacteria 5389
52 Ga0307508_10006491 3300031616 Bacteria 11001
53 Ga0307405_10301396 3300031731 Bacteria 1216
54 Ga0307410_10091220 3300031852 Bacteria 2163
55 Ga0307410_10132993 3300031852 Bacteria 1830
56 Ga0307407_10003649 3300031903 Bacteria 6366
57 Ga0307409_100121653 3300031995 Bacteria 2212
58 Ga0307409_100397575 3300031995 Bacteria 1315
59 Ga0307409_100457561 3300031995 Bacteria 1233
60 Ga0307416_100273906 3300032002 Bacteria 1659
61 Ga0307416_100336768 3300032002 Bacteria 1519
62 Ga0307414_10221011 3300032004 Bacteria 1555
63 Ga0307415_100413141 3300032126 Bacteria 1156
64 Ga0307507_10236866 3300033179 Bacteria 1201
65 Ga0373925_0053487 3300037068 Bacteria 3019
66 Ga0373925_0495431 3300037068 Bacteria 1003
67 Ga0395898_0609447 3300037466 Bacteria 1035
68 Ga0436364_0875470 3300037853 Bacteria 1706
69 Ga0395901_0165002 3300038443 Bacteria 2326
70 Ga0395901_0774794 3300038443 Bacteria 950
71 Ga0466969_0091371 3300044656 Bacteria 1442
72 Ga0466972_0016216 3300044658 Bacteria 3723
73 Ga0466961_0038604 3300044693 Bacteria 3063
74 Ga0466961_0106614 3300044693 Bacteria 1764
75 Ga0466963_0121838 3300044694 Bacteria 1796
76 Ga0466971_0002370 3300044719 Bacteria 7957
77 Ga0466970_0047487 3300044765 Bacteria 2288
78 Ga0466957_0058383 3300044842 Bacteria 2364
79 Ga0466960_0026645 3300044901 Bacteria 2628
80 Ga0466960_0041190 3300044901 Bacteria 2188
81 Ga0466959_0353684 3300045049 Bacteria 1001
82 Ga0466967_0081078 3300045976 Bacteria 2930
83 Ga0495618_0087300 3300046514 Bacteria 1995
84 Ga0495628_0107066 3300046516 Bacteria 2153
85 Ga0496100_0248355 3300048903 Bacteria 1315
86 Ga0496101_0023636 3300048904 Bacteria 4248
87 Ga0496102_0000072 3300048905 Bacteria 150284
88 Ga0496102_0000683 3300048905 Bacteria 33959
89 Ga0496103_0000158 3300048906 Bacteria 71302
90 Ga0496103_0058660 3300048906 Bacteria 2391
91 Ga0496106_0384705 3300048909 Bacteria 1127
92 Ga0496107_0043858 3300048910 Bacteria 3214
93 Ga0496108_0294375 3300048911 Bacteria 1413
94 Ga0496108_0354258 3300048911 Bacteria 1281
95 Ga0496109_0269998 3300048912 Bacteria 1602
96 Ga0496112_0135995 3300048915 Bacteria 2428
97 Ga0496117_0167378 3300048920 Bacteria 1280
98 Ga0496118_0033326 3300048921 Bacteria 4228
99 Ga0496119_0033463 3300048922 Bacteria 3406
100 Ga0496121_0074575 3300048924 Bacteria 2713
101 Ga0501047_0032938 3300049581 Bacteria 5004
102 Ga0501067_0014573 3300049583 Bacteria 4352
103 nmdc:mga05p37_2846_c1 3300050507 Bacteria 20103
104 nmdc:mga09592_265247_c1 3300050508 Bacteria 1490
105 nmdc:mga0qj67_308521_c1 3300050509 Bacteria 1282
106 nmdc:mga06r32_17978_c1 3300050510 Bacteria 6463
107 Ga0500644_0027003 3300053088 Bacteria 1782
108 Ga0500654_049835 3300053099 Bacteria 2267
109 Ga0466962_0007128 3300061719 Bacteria 5353
110 Ga0466962_0070015 3300061719 Bacteria 1675
111 2643897493 2643221578 Bacteria 9213798
112 2554257176 2554235005 Bacteria 6457341
113 2643759421 2643221548 Bacteria 8053412
114 2644388394 2643221670 Bacteria 6497041
115 2644408637 2643221673 Bacteria 9196637
116 2644463163 2643221682 Bacteria 6743283
117 2793984134 2791355406 Bacteria 11364898
118 2819675241 2818991459 Bacteria 8736032
119 2819694003 2818991463 Bacteria 7948711
120 2856745329 2856741275 Bacteria 8096094
121 2857469335 2857465823 Bacteria 6772595
122 2873157819 2873151551 Bacteria 8625867
123 2875393439 2875391855 Bacteria 7600475
124 2904760545 2904755435 Bacteria 7986759
125 2946051256 2946045630 Bacteria 8527308
126 2966603624 2966598605 Bacteria 7676064
127 2990089644 2990088156 Bacteria 6657676
128 3003001112 3002998708 Bacteria 11715108
129 8003321168 8003314358 Bacteria 10575343
130 8047899098 8047893842 Bacteria 11723082
131 8048127557 8048127548 Bacteria 11053136
132 8048359821 8048356638 Bacteria 11044339
133 8048376062 8048369669 Bacteria 11666822
134 8048385121 8048379754 Bacteria 11877923
135 8053947521 8053945823 Bacteria 8962862
136 Ga0070683_100549110
137 Ga0070670_100304271
138 Ga0070666_10023423
139 Ga0070680_100335207
140 Ga0070682_100007472
141 Ga0068868_100186161
142 Ga0070668_100006122
143 Ga0070671_100011859
144 Ga0070667_100002062
145 Ga0070665_100000362
146 Ga0068857_100030577
147 Ga0068852_100001272
148 Ga0068859_100002497
149 Ga0068861_100485563
150 Ga0068863_100006721
151 Ga0068858_100025772
152 Ga0068860_100000035
153 Ga0075428_100002554
154 Ga0075429_100001358
155 Ga0097620_100002497
156 Ga0105245_10030380
157 Ga0105247_10012052
158 Ga0114129_10003492
159 Ga0105241_10071061
160 Ga0105249_10241271
161 Ga0157374_10311340
162 Ga0157372_10120496
163 Ga0157379_10009147
164 Ga0207426_1019254
165 Ga0207710_10006082
166 Ga0207680_10001726
167 Ga0207654_10097914
168 Ga0207650_10181145
169 Ga0207687_10014753
170 Ga0207664_10494805
171 Ga0207661_10211991
172 Ga0207668_10012405
173 Ga0207668_10036842
174 Ga0207658_10013834
175 Ga0207677_10049973
176 Ga0207677_10506342
177 Ga0207703_10018654
178 Ga0207702_10208795
179 Ga0207641_10003666
180 Ga0207674_10062558
181 Ga0207674_10352866
182 Ga0207675_100647217
183 Ga0207698_10003187
184 Ga0268266_10008736
185 Ga0268264_10000031
186 Ga0307515_10060644
187 Ga0307508_10006491
188 Ga0307405_10301396
189 Ga0307410_10091220
190 Ga0307410_10132993
191 Ga0307407_10003649
192 Ga0307409_100121653
193 Ga0307409_100397575
194 Ga0307409_100457561
195 Ga0307416_100273906
196 Ga0307416_100336768
197 Ga0307414_10221011
198 Ga0307415_100413141
199 Ga0307507_10236866
200 Ga0373925_0053487
201 Ga0373925_0495431
202 Ga0395898_0609447
203 Ga0436364_0875470
204 Ga0395901_0165002
205 Ga0395901_0774794
206 Ga0466969_0091371
207 Ga0466972_0016216
208 Ga0466961_0038604
209 Ga0466961_0106614
210 Ga0466963_0121838
211 Ga0466971_0002370
212 Ga0466970_0047487
213 Ga0466957_0058383
214 Ga0466960_0026645
215 Ga0466960_0041190
216 Ga0466959_0353684
217 Ga0466967_0081078
218 Ga0495618_0087300
219 Ga0495628_0107066
220 Ga0496100_0248355
221 Ga0496101_0023636
222 Ga0496102_0000072
223 Ga0496102_0000683
224 Ga0496103_0000158
225 Ga0496103_0058660
226 Ga0496106_0384705
227 Ga0496107_0043858
228 Ga0496108_0294375
229 Ga0496108_0354258
230 Ga0496109_0269998
231 Ga0496112_0135995
232 Ga0496117_0167378
233 Ga0496118_0033326
234 Ga0496119_0033463
235 Ga0496121_0074575
236 Ga0501047_0032938
237 Ga0501067_0014573
238 nmdc:mga05p37_2846_c1
239 nmdc:mga09592_265247_c1
240 nmdc:mga0qj67_308521_c1
241 nmdc:mga06r32_17978_c1
242 Ga0500644_0027003
243 Ga0500654_049835
244 Ga0466962_0007128
245 Ga0466962_0070015
246 2643897493
247 2554257176
248 2643759421
249 2644388394
250 2644408637
251 2644463163
252 2793984134
253 2819675241
254 2819694003
255 2856745329
256 2857469335
257 2873157819
258 2875393439
259 2904760545
260 2946051256
261 2966603624
262 2990089644
263 3003001112
264 8003321168
265 8047899098
266 8048127557
267 8048359821
268 8048376062
269 8048385121
270 8053947521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

70

208

0.84

PF13649

Methyltransf_25

Methyltransferase domain

102

192

0.82

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

85

175

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.8598 7 258
1sg9-assembly2.cif.gz_B crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase 0.8514 7 258
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.8383 7 258
1vq1-assembly1.cif.gz_A crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.8326 7 258
1sg9-assembly2.cif.gz_B crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase 0.83 7 258
ID Description Score Start End Superfamily
af_Q9FMI5_170_376_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9257 66 257 3.40.50.150
af_F1QJH5_134_342_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9186 66 258 3.40.50.150
af_Q9VMD3_119_323_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.916 66 258 3.40.50.150
af_P9WHV3_83_284_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.906 66 257 3.40.50.150
af_Q9Y5R4_126_337_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9023 68 257 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A368T2Q7-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9804 6 257 GO:0008276
GO:0032259
AF-A0A402GC14-F1-model_v4 deleted 0.9792 72 257
AF-A0A239N400-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9791 41 258 GO:0008276
GO:0032259
AF-A0A2S9D727-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9784 7 258 GO:0008276
GO:0032259
AF-A0A7W8BJD4-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9743 6 257 GO:0008276
GO:0032259
GO:0102559

Map