F164733

General Info

Members Datasets Scaffolds Average Seq Length
135 110 135 101

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_518772_c1|nmdc:mga07m45_518772_c1_180_551
Length 123
Sequence VLRRRSDLPGCYNRPAENKKKTMGWATHHIAKLKTGLTVSFRPRGNSMRGKIESGQLCTVEPIADHAALEAGDIVLCKVAGHEYLHLIKAIQGPRFQIGNNRGGINGWITASGIYGRCIKVEP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
109 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
110 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 0
Rhizoplane 1.48
Rhizosphere 74.81
Stem 0
Stem Tuber 0
Unclassified 19.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4871536 2162886011 Unclassified 859
2 JGI25406J46586_10029493 3300003203 Unclassified 2076
3 JGI25406J46586_10203134 3300003203 Unclassified 579
4 rootH2_10001975 3300003320 Bacteria 376986
5 rootL2_10126880 3300003322 Bacteria 2836
6 Ga0065712_10507200 3300005290 Unclassified 645
7 Ga0065707_10196270 3300005295 Unclassified 1334
8 Ga0065707_10527683 3300005295 Bacteria 737
9 Ga0070683_100192096 3300005329 Unclassified 1939
10 Ga0070670_101449776 3300005331 Bacteria 630
11 Ga0068869_100008836 3300005334 Bacteria 6519
12 Ga0070692_11019981 3300005345 Bacteria 580
13 Ga0070673_100074875 3300005364 Unclassified 2729
14 Ga0070688_100063157 3300005365 Unclassified 2346
15 Ga0070659_101139900 3300005366 Bacteria 688
16 Ga0070713_100594013 3300005436 Unclassified 1051
17 Ga0070694_100059510 3300005444 Unclassified 2602
18 Ga0070694_100200826 3300005444 Bacteria 1486
19 Ga0070685_10003338 3300005466 Bacteria 8166
20 Ga0070685_10213263 3300005466 Unclassified 1261
21 Ga0070706_100183335 3300005467 Bacteria 1955
22 Ga0070707_100424230 3300005468 Bacteria 1290
23 Ga0070707_100592359 3300005468 Bacteria 1071
24 Ga0070698_101210222 3300005471 Bacteria 705
25 Ga0070684_100825845 3300005535 Unclassified 867
26 Ga0070686_100000013 3300005544 Bacteria 169327
27 Ga0070695_100141202 3300005545 Unclassified 1670
28 Ga0070696_100198336 3300005546 Bacteria 1497
29 Ga0070704_100015593 3300005549 Bacteria 4778
30 Ga0068855_100086184 3300005563 Bacteria 3632
31 Ga0068856_101730693 3300005614 Bacteria 637
32 Ga0068852_100881883 3300005616 Bacteria 911
33 Ga0068861_100897512 3300005719 Bacteria 839
34 Ga0068861_101852057 3300005719 Unclassified 599
35 Ga0068858_101174059 3300005842 Unclassified 754
36 Ga0081539_10006397 3300005985 Bacteria 11329
37 Ga0081539_10091872 3300005985 Bacteria 1567
38 Ga0075363_100676186 3300006048 Unclassified 622
39 Ga0075432_10434056 3300006058 Unclassified 573
40 Ga0097621_100829409 3300006237 Bacteria 858
41 Ga0075370_10168203 3300006353 Bacteria 1288
42 Ga0075430_100312838 3300006846 Bacteria 1299
43 Ga0075431_101489625 3300006847 Unclassified 635
44 Ga0075429_100020506 3300006880 Bacteria 5736
45 Ga0075429_100334607 3300006880 Bacteria 1325
46 Ga0105240_10756291 3300009093 Unclassified 1056
47 Ga0111539_10156119 3300009094 Unclassified 2670
48 Ga0105245_10000046 3300009098 Bacteria 132997
49 Ga0114129_13513957 3300009147 Unclassified 501
50 Ga0105242_12151172 3300009176 Unclassified 602
51 Ga0105248_11621496 3300009177 Bacteria 733
52 Ga0105237_10000033 3300009545 Bacteria 191935
53 Ga0105237_10149507 3300009545 Bacteria 2331
54 Ga0105249_11988366 3300009553 Unclassified 654
55 Ga0105239_10465321 3300010375 Viruses 1435
56 Ga0157369_10207880 3300013105 Unclassified 2052
57 Ga0157369_10242079 3300013105 Unclassified 1884
58 Ga0157378_11284129 3300013297 Bacteria 773
59 Ga0157375_11742217 3300013308 Unclassified 738
60 Ga0163163_10274355 3300014325 Bacteria 1737
61 Ga0157380_12400082 3300014326 Bacteria 592
62 Ga0182006_1293500 3300015261 Bacteria 533
63 Ga0206352_10704618 3300020078 Bacteria 805
64 Ga0213876_10000052 3300021384 Bacteria 144098
65 Ga0213876_10003198 3300021384 Bacteria 9412
66 Ga0213876_10009087 3300021384 Bacteria 5351
67 Ga0213876_10241125 3300021384 Bacteria 961
68 Ga0213875_10515174 3300021388 Unclassified 575
69 Ga0207684_10190720 3300025910 Bacteria 1768
70 Ga0207654_10009150 3300025911 Bacteria 5023
71 Ga0207671_10000006 3300025914 Bacteria 836809
72 Ga0207671_10207514 3300025914 Bacteria 1531
73 Ga0207657_10657429 3300025919 Bacteria 816
74 Ga0207646_10090200 3300025922 Bacteria 2744
75 Ga0207687_11745777 3300025927 Unclassified 533
76 Ga0207689_10026094 3300025942 Bacteria 4892
77 Ga0207661_10160879 3300025944 Unclassified 1948
78 Ga0207667_11043034 3300025949 Bacteria 803
79 Ga0207658_10858720 3300025986 Unclassified 825
80 Ga0207677_10152939 3300026023 Bacteria 1783
81 Ga0207703_11127060 3300026035 Unclassified 754
82 Ga0207641_11582439 3300026088 Unclassified 657
83 Ga0207675_100055193 3300026118 Bacteria 3706
84 Ga0307515_10000005 3300028794 Bacteria 758563
85 Ga0307515_10548509 3300028794 Unclassified 766
86 Ga0307511_10000804 3300030521 Bacteria 33483
87 Ga0307513_10021444 3300031456 Bacteria 7626
88 Ga0265314_10018250 3300031711 Bacteria 5475
89 Ga0307406_12069975 3300031901 Unclassified 510
90 Ga0307412_10052550 3300031911 Bacteria 2699
91 Ga0307409_100086007 3300031995 Bacteria 2558
92 Ga0307416_100937873 3300032002 Bacteria 967
93 Ga0307415_100052000 3300032126 Bacteria 2784
94 Ga0373948_0053954 3300034817 Unclassified 869
95 Ga0373949_0000130 3300035090 Bacteria 28037
96 Ga0373937_0570906 3300036401 Unclassified 1074
97 Ga0395905_0000251 3300037471 Bacteria 80132
98 Ga0395905_0365799 3300037471 Bacteria 1335
99 Ga0436364_1169951 3300037853 Bacteria 644
100 Ga0400483_214453 3300039062 Bacteria 1448
101 Ga0436365_0384404 3300039437 Unclassified 774
102 Ga0436365_0406589 3300039437 Bacteria 138542
103 Ga0436365_0611471 3300039437 Bacteria 2270
104 Ga0436365_0984517 3300039437 Bacteria 10013
105 Ga0436365_1065463 3300039437 Bacteria 2189
106 Ga0436365_1229368 3300039437 Bacteria 11132
107 Ga0436361_0324114 3300039447 Bacteria 664
108 Ga0436363_0547722 3300039450 Bacteria 1378
109 Ga0436363_1089472 3300039450 Bacteria 607
110 Ga0436362_1264437 3300039453 Bacteria 554
111 Ga0451789_1243748 3300041443 Bacteria 749
112 Ga0451839_0304422 3300041496 Unclassified 568
113 Ga0451843_0786035 3300041509 Bacteria 722
114 Ga0451853_0925021 3300041512 Bacteria 632
115 Ga0451853_1964432 3300041512 Unclassified 718
116 Ga0451853_2447305 3300041512 Bacteria 663
117 Ga0451577_0738721 3300042876 Unclassified 890
118 Ga0453684_0000470 3300044712 Bacteria 160002
119 Ga0451576_0232103 3300045051 Bacteria 1927
120 Ga0495596_0055559 3300046500 Unclassified 1547
121 Ga0495657_0248542 3300046675 Bacteria 1071
122 Ga0495604_0231059 3300047317 Bacteria 1269
123 Ga0495683_0047979 3300047323 Bacteria 2142
124 Ga0495675_0506628 3300047444 Bacteria 693
125 Ga0496111_0597843 3300048914 Unclassified 808
126 nmdc:mga07m45_518772_c1 3300050496 Unclassified 690
127 nmdc:mga09592_21534_c1 3300050508 Bacteria 5313
128 nmdc:mga0qj67_1171244_c1 3300050509 Bacteria 599
129 nmdc:mga06r32_1363314_c1 3300050510 Unclassified 652
130 nmdc:mga06r32_557470_c1 3300050510 Bacteria 1119
131 nmdc:mga08y16_99993_c1 3300050511 Unclassified 977
132 nmdc:mga0rr50_576961_c1 3300050513 Bacteria 958
133 nmdc:mga0sz30_40794_c1 3300050516 Bacteria 1951
134 Ga0500583_0034620 3300053092 Bacteria 2246
135 Ga0500556_0002886 3300053104 Bacteria 5232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10003198 Ga0213876_1000319812 80
2 3300039437 Ga0436365_1229368 Ga0436365_1229368_6984_7232 80
3 3300006237 Ga0097621_100829409 Ga0097621_1008294092 84
4 3300026023 Ga0207677_10152939 Ga0207677_101529392 84
5 3300039437 Ga0436365_0984517 Ga0436365_0984517_9205_9549 88
6 3300035090 Ga0373949_0000130 Ga0373949_0000130_6129_6407 92
7 3300039437 Ga0436365_0384404 Ga0436365_0384404_452_760 92
8 3300005329 Ga0070683_100192096 Ga0070683_1001920963 99
9 3300005331 Ga0070670_101449776 Ga0070670_1014497761 99
10 3300005366 Ga0070659_101139900 Ga0070659_1011399001 99
11 3300005466 Ga0070685_10003338 Ga0070685_100033385 99
12 3300005544 Ga0070686_100000013 Ga0070686_10000001324 99
13 3300005985 Ga0081539_10091872 Ga0081539_100918722 99
14 3300006058 Ga0075432_10434056 Ga0075432_104340561 99
15 3300013105 Ga0157369_10207880 Ga0157369_102078803 99
16 3300021384 Ga0213876_10000052 Ga0213876_1000005244 99
17 3300021388 Ga0213875_10515174 Ga0213875_105151742 99
18 3300025944 Ga0207661_10160879 Ga0207661_101608792 99
19 3300037853 Ga0436364_1169951 Ga0436364_1169951_319_618 99
20 3300039437 Ga0436365_0406589 Ga0436365_0406589_58730_59029 99
21 3300041443 Ga0451789_1243748 Ga0451789_1243748_181_480 99
22 3300041496 Ga0451839_0304422 Ga0451839_0304422_204_533 99
23 3300041509 Ga0451843_0786035 Ga0451843_0786035_373_675 99
24 3300046500 Ga0495596_0055559 Ga0495596_0055559_1008_1307 99
25 3300050509 nmdc:mga0qj67_1171244_c1 nmdc:mga0qj67_1171244_c1_38_340 99
26 3300050513 nmdc:mga0rr50_576961_c1 nmdc:mga0rr50_576961_c1_403_702 99
27 2162886011 MRS1b_contig_4871536 MRS1b_0706.00000230 100
28 3300003203 JGI25406J46586_10029493 JGI25406J46586_100294934 100
29 3300003203 JGI25406J46586_10203134 JGI25406J46586_102031342 100
30 3300003320 rootH2_10001975 rootH2_10001975123 100
31 3300003322 rootL2_10126880 rootL2_101268802 100
32 3300005290 Ga0065712_10507200 Ga0065712_105072002 100
33 3300005295 Ga0065707_10196270 Ga0065707_101962703 100
34 3300005295 Ga0065707_10527683 Ga0065707_105276831 100
35 3300005334 Ga0068869_100008836 Ga0068869_1000088367 100
36 3300005345 Ga0070692_11019981 Ga0070692_110199812 100
37 3300005364 Ga0070673_100074875 Ga0070673_1000748752 100
38 3300005365 Ga0070688_100063157 Ga0070688_1000631572 100
39 3300005436 Ga0070713_100594013 Ga0070713_1005940134 100
40 3300005444 Ga0070694_100059510 Ga0070694_1000595104 100
41 3300005444 Ga0070694_100200826 Ga0070694_1002008262 100
42 3300005466 Ga0070685_10213263 Ga0070685_102132633 100
43 3300005467 Ga0070706_100183335 Ga0070706_1001833353 100
44 3300005468 Ga0070707_100424230 Ga0070707_1004242301 100
45 3300005468 Ga0070707_100592359 Ga0070707_1005923592 100
46 3300005471 Ga0070698_101210222 Ga0070698_1012102221 100
47 3300005535 Ga0070684_100825845 Ga0070684_1008258451 100
48 3300005545 Ga0070695_100141202 Ga0070695_1001412023 100
49 3300005546 Ga0070696_100198336 Ga0070696_1001983361 100
50 3300005549 Ga0070704_100015593 Ga0070704_1000155933 100
51 3300005563 Ga0068855_100086184 Ga0068855_1000861841 100
52 3300005614 Ga0068856_101730693 Ga0068856_1017306932 100
53 3300005616 Ga0068852_100881883 Ga0068852_1008818832 100
54 3300005719 Ga0068861_100897512 Ga0068861_1008975122 100
55 3300005719 Ga0068861_101852057 Ga0068861_1018520571 100
56 3300005842 Ga0068858_101174059 Ga0068858_1011740592 100
57 3300005985 Ga0081539_10006397 Ga0081539_1000639717 100
58 3300006048 Ga0075363_100676186 Ga0075363_1006761862 100
59 3300006353 Ga0075370_10168203 Ga0075370_101682032 100
60 3300006846 Ga0075430_100312838 Ga0075430_1003128383 100
61 3300006847 Ga0075431_101489625 Ga0075431_1014896251 100
62 3300006880 Ga0075429_100020506 Ga0075429_1000205066 100
63 3300006880 Ga0075429_100334607 Ga0075429_1003346072 100
64 3300009093 Ga0105240_10756291 Ga0105240_107562911 100
65 3300009094 Ga0111539_10156119 Ga0111539_101561194 100
66 3300009098 Ga0105245_10000046 Ga0105245_1000004633 100
67 3300009147 Ga0114129_13513957 Ga0114129_135139571 100
68 3300009176 Ga0105242_12151172 Ga0105242_121511721 100
69 3300009177 Ga0105248_11621496 Ga0105248_116214961 100
70 3300009545 Ga0105237_10000033 Ga0105237_10000033136 100
71 3300009545 Ga0105237_10149507 Ga0105237_101495072 100
72 3300009553 Ga0105249_11988366 Ga0105249_119883661 100
73 3300010375 Ga0105239_10465321 Ga0105239_104653212 100
74 3300013105 Ga0157369_10242079 Ga0157369_102420794 100
75 3300013297 Ga0157378_11284129 Ga0157378_112841292 100
76 3300013308 Ga0157375_11742217 Ga0157375_117422171 100
77 3300014325 Ga0163163_10274355 Ga0163163_102743553 100
78 3300014326 Ga0157380_12400082 Ga0157380_124000821 100
79 3300015261 Ga0182006_1293500 Ga0182006_12935001 100
80 3300020078 Ga0206352_10704618 Ga0206352_107046182 100
81 3300021384 Ga0213876_10009087 Ga0213876_1000908710 100
82 3300021384 Ga0213876_10241125 Ga0213876_102411251 100
83 3300025910 Ga0207684_10190720 Ga0207684_101907202 100
84 3300025911 Ga0207654_10009150 Ga0207654_100091503 100
85 3300025914 Ga0207671_10000006 Ga0207671_10000006505 100
86 3300025914 Ga0207671_10207514 Ga0207671_102075142 100
87 3300025919 Ga0207657_10657429 Ga0207657_106574292 100
88 3300025922 Ga0207646_10090200 Ga0207646_100902002 100
89 3300025927 Ga0207687_11745777 Ga0207687_117457771 100
90 3300025942 Ga0207689_10026094 Ga0207689_100260947 100
91 3300025949 Ga0207667_11043034 Ga0207667_110430341 100
92 3300025986 Ga0207658_10858720 Ga0207658_108587202 100
93 3300026035 Ga0207703_11127060 Ga0207703_111270602 100
94 3300026088 Ga0207641_11582439 Ga0207641_115824391 100
95 3300026118 Ga0207675_100055193 Ga0207675_1000551931 100
96 3300028794 Ga0307515_10000005 Ga0307515_1000000512 100
97 3300028794 Ga0307515_10548509 Ga0307515_105485091 100
98 3300030521 Ga0307511_10000804 Ga0307511_1000080413 100
99 3300031456 Ga0307513_10021444 Ga0307513_100214444 100
100 3300031711 Ga0265314_10018250 Ga0265314_100182503 100
101 3300031901 Ga0307406_12069975 Ga0307406_120699752 100
102 3300031911 Ga0307412_10052550 Ga0307412_100525503 100
103 3300031995 Ga0307409_100086007 Ga0307409_1000860073 100
104 3300032002 Ga0307416_100937873 Ga0307416_1009378732 100
105 3300032126 Ga0307415_100052000 Ga0307415_1000520003 100
106 3300034817 Ga0373948_0053954 Ga0373948_0053954_442_744 100
107 3300036401 Ga0373937_0570906 Ga0373937_0570906_174_479 100
108 3300037471 Ga0395905_0000251 Ga0395905_0000251_20567_20917 100
109 3300037471 Ga0395905_0365799 Ga0395905_0365799_469_774 100
110 3300039062 Ga0400483_214453 Ga0400483_214453_1049_1351 100
111 3300039437 Ga0436365_0611471 Ga0436365_0611471_1360_1668 100
112 3300039437 Ga0436365_1065463 Ga0436365_1065463_1121_1429 100
113 3300039447 Ga0436361_0324114 Ga0436361_0324114_156_458 100
114 3300039450 Ga0436363_0547722 Ga0436363_0547722_439_747 100
115 3300039450 Ga0436363_1089472 Ga0436363_1089472_211_519 100
116 3300039453 Ga0436362_1264437 Ga0436362_1264437_233_541 100
117 3300041512 Ga0451853_0925021 Ga0451853_0925021_128_430 100
118 3300041512 Ga0451853_1964432 Ga0451853_1964432_171_476 100
119 3300041512 Ga0451853_2447305 Ga0451853_2447305_197_499 100
120 3300042876 Ga0451577_0738721 Ga0451577_0738721_111_413 100
121 3300044712 Ga0453684_0000470 Ga0453684_0000470_142957_143259 100
122 3300045051 Ga0451576_0232103 Ga0451576_0232103_154_456 100
123 3300046675 Ga0495657_0248542 Ga0495657_0248542_81_389 100
124 3300047317 Ga0495604_0231059 Ga0495604_0231059_247_555 100
125 3300047323 Ga0495683_0047979 Ga0495683_0047979_574_876 100
126 3300047444 Ga0495675_0506628 Ga0495675_0506628_90_398 100
127 3300048914 Ga0496111_0597843 Ga0496111_0597843_330_632 100
128 3300050496 nmdc:mga07m45_518772_c1 nmdc:mga07m45_518772_c1_180_551 100
129 3300050508 nmdc:mga09592_21534_c1 nmdc:mga09592_21534_c1_4496_4798 100
130 3300050510 nmdc:mga06r32_1363314_c1 nmdc:mga06r32_1363314_c1_44_346 100
131 3300050510 nmdc:mga06r32_557470_c1 nmdc:mga06r32_557470_c1_124_441 100
132 3300050511 nmdc:mga08y16_99993_c1 nmdc:mga08y16_99993_c1_35_340 100
133 3300050516 nmdc:mga0sz30_40794_c1 nmdc:mga0sz30_40794_c1_11_382 100
134 3300053092 Ga0500583_0034620 Ga0500583_0034620_404_709 100
135 3300053104 Ga0500556_0002886 Ga0500556_0002886_4290_4592 100

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.8512 16 100
6v9t-assembly1.cif.gz_AAA tudor domain of tdrd3 in complex with a small molecule 0.8184 47 92
4wvh-assembly1.cif.gz_A crystal structure of the type-i signal peptidase from staphylococcus aureus (spsb) in complex with a substrate peptide (pep1). 0.8172 14 95
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.8158 15 100
6kco-assembly3.cif.gz_E shuguo pwwp in complex with ssdna 0.8118 46 92
ID Description Score Start End Superfamily
af_Q96LU5_28_157_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8591 14 95 2.10.109.10
1kn9D01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8283 15 98 2.10.109.10
af_Q9VXR8_27_156_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8275 16 96 2.10.109.10
af_C4JC55_378_443_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8271 47 91 2.30.30.140
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8259 11 99 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A6C2YUN2-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9847 3 100
AF-A0A2I9DR93-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9789 14 100
AF-A0A517VAP7-F1-model_v4 Uncharacterized protein 0.9751 2 100
AF-A0A512MBM9-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9708 1 100
AF-A0A6P2DML2-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9694 1 100

Feature Viewer

pLDDT pTM Quality
94.14 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map