F164164

General Info

Members Datasets Scaffolds Average Seq Length
135 123 270 276

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0083346|Ga0466972_0083346_70_1032
Length 320
Sequence MAAKLGNASRIRDVPPFPSWAFHGWFIVSQTLPSSRNLHFDQEHMMPATPNIRLNDGQTMPQLGYGVWQVTNQEAATTVGTAIEAGYRSIDTAAIYGNEGGVGQAIAASPVPRSELFITTKLWNDKHGFDTALKAFDESLNRLKLDFVDLYLIHWPVAGSQAYLDAWRALIRIKEEGRAKSIGVSNFNIEHLKRLKDETGITPAVNQIELHPRFQQKELRAFHAENGIATESWSPLGQGSLIENDTLVAIGRKYNKSSAQVILRWHLDNGLIVIPKSVTPSRIRENIDVFDFKLDAEDMRAIEALDDKGGRVGPNPAVFG

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
32 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
44 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
47 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
48 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
64 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
65 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
66 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
67 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
68 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
69 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
76 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
77 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
80 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
81 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
88 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
89 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
90 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
91 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
92 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
93 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
94 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
95 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
96 2534681786 Brucella suis 92/29 Isolate Unclassified
97 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
98 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
99 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
100 2643221548 Streptomyces sp. Root55 Isolate Unclassified
101 2643221670 Streptomyces sp. Root431 Isolate Unclassified
102 2643221674 Devosia sp. Root436 Isolate Unclassified
103 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
104 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
105 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
106 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
107 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
108 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
109 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
110 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
111 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
112 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
113 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
114 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
115 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
116 2909042592 Labrys sp. LIt4 Isolate Nodule
117 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
118 2922554459 Rhodococcus sp. 66b Isolate Unclassified
119 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
120 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
121 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
122 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
123 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.78
Metatranscriptomes 0.74
Isolates 21.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.11
Nodule 5.19
Rhizoplane 2.22
Rhizosphere 60.74
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0083346 3300044658 Bacteria 1521
2 JGI24740J21852_10014894 3300001979 Bacteria 2855
3 JGI24740J21852_10038894 3300001979 Bacteria 1456
4 JGI24739J22299_10004789 3300001989 Bacteria 5167
5 JGI24737J22298_10012631 3300001990 Bacteria 2753
6 JGI24735J21928_10028988 3300002067 Bacteria 1651
7 rootH2_10015229 3300003320 Bacteria 17447
8 rootH1_10039424 3300003323 Bacteria 18307
9 rootH1_10063462 3300003323 Bacteria 6542
10 JGI25160J50197_1002375 3300003354 Bacteria 8791
11 Ga0065165_1005940 3300005262 Bacteria 6610
12 Ga0065165_1054507 3300005262 Bacteria 1120
13 Ga0070658_10667415 3300005327 Bacteria 902
14 Ga0070670_100000116 3300005331 Bacteria 74586
15 Ga0070713_100120807 3300005436 Bacteria 2297
16 Ga0070706_100278010 3300005467 Bacteria 1562
17 Ga0070707_100497448 3300005468 Bacteria 1181
18 Ga0070698_100084306 3300005471 Bacteria 3166
19 Ga0070699_100003084 3300005518 Bacteria 14772
20 Ga0070699_100187045 3300005518 Bacteria 1839
21 Ga0070697_100047797 3300005536 Bacteria 3469
22 Ga0070697_100065685 3300005536 Bacteria 2965
23 Ga0068853_100194204 3300005539 Bacteria 1845
24 Ga0070696_100074768 3300005546 Bacteria 2389
25 Ga0070696_100433853 3300005546 Bacteria 1034
26 Ga0068852_100028721 3300005616 Bacteria 4558
27 Ga0075363_100076713 3300006048 Bacteria 1823
28 Ga0070716_100026760 3300006173 Bacteria 3091
29 Ga0070712_100322418 3300006175 Unclassified 1257
30 Ga0075369_10010773 3300006186 Bacteria 3582
31 Ga0099795_10033624 3300007788 Bacteria 1782
32 Ga0111539_10408643 3300009094 Bacteria 1581
33 Ga0105238_10501524 3300009551 Bacteria 1215
34 Ga0157374_10337003 3300013296 Bacteria 1497
35 Ga0157380_10285191 3300014326 Bacteria 1513
36 Ga0206352_10610635 3300020078 Bacteria 3956
37 Ga0209026_1003988 3300025250 Bacteria 4601
38 Ga0209130_1001508 3300025284 Bacteria 15025
39 Ga0207426_1001035 3300025302 Bacteria 26507
40 Ga0207692_10096634 3300025898 Bacteria 1613
41 Ga0207647_10015532 3300025904 Bacteria 5217
42 Ga0207671_10000203 3300025914 Bacteria 90100
43 Ga0207693_10227114 3300025915 Bacteria 1466
44 Ga0207700_10088675 3300025928 Unclassified 2436
45 Ga0207665_10026745 3300025939 Bacteria 3811
46 Ga0207665_10055578 3300025939 Bacteria 2671
47 Ga0207691_10442754 3300025940 Bacteria 1106
48 Ga0207640_10029982 3300025981 Bacteria 3346
49 Ga0209371_1002137 3300027312 Bacteria 11639
50 Ga0265337_1005180 3300028556 Bacteria 5232
51 Ga0265326_10006685 3300028558 Bacteria 3566
52 Ga0265319_1000542 3300028563 Bacteria 25697
53 Ga0265318_10002916 3300028577 Bacteria 8883
54 Ga0265322_10016691 3300028654 Bacteria 2118
55 Ga0265336_10000005 3300028666 Bacteria 399349
56 Ga0307515_10260116 3300028794 Bacteria 1473
57 Ga0265338_10000001 3300028800 Bacteria 1177449
58 Ga0265324_10011434 3300029957 Bacteria 3381
59 Ga0265320_10026537 3300031240 Bacteria 3030
60 Ga0265340_10000001 3300031247 Bacteria 1647668
61 Ga0265339_10168180 3300031249 Bacteria 1099
62 Ga0307508_10016315 3300031616 Bacteria 6762
63 Ga0307518_10001024 3300031838 Bacteria 20910
64 Ga0307407_10422779 3300031903 Bacteria 961
65 Ga0307414_10458387 3300032004 Bacteria 1120
66 Ga0395900_0054730 3300037418 Bacteria 4108
67 Ga0395898_0059489 3300037466 Bacteria 3716
68 Ga0395905_0000281 3300037471 Bacteria 75241
69 Ga0436365_0842249 3300039437 Bacteria 3205
70 Ga0436365_1877132 3300039437 Bacteria 3691
71 Ga0439436_0005423 3300041404 Bacteria 3907
72 Ga0439439_0029130 3300041406 Bacteria 1400
73 Ga0451791_0905739 3300041451 Bacteria 2311
74 Ga0451793_0096708 3300041452 Bacteria 2904
75 Ga0439449_0016004 3300042007 Bacteria 2819
76 Ga0439457_001665 3300042014 Bacteria 6603
77 Ga0450906_002652 3300042145 Bacteria 3898
78 Ga0466963_0002335 3300044694 Bacteria 10576
79 Ga0453684_0094202 3300044712 Bacteria 3685
80 Ga0466970_0007275 3300044765 Bacteria 5546
81 Ga0466957_0341444 3300044842 Bacteria 1014
82 Ga0466967_0000204 3300045976 Bacteria 24854
83 Ga0495668_0001929 3300046616 Bacteria 18435
84 Ga0495668_0038391 3300046616 Bacteria 2675
85 Ga0495672_0009773 3300047320 Bacteria 6911
86 Ga0496108_0334185 3300048911 Bacteria 1321
87 Ga0496117_0001332 3300048920 Bacteria 36331
88 Ga0496122_0003472 3300048925 Bacteria 20737
89 Ga0496123_0020638 3300048926 Bacteria 5148
90 Ga0496125_0049704 3300048928 Bacteria 3480
91 Ga0501034_0003356 3300049571 Bacteria 18272
92 Ga0501034_0249255 3300049571 Bacteria 1720
93 Ga0501037_0047887 3300049573 Bacteria 3132
94 Ga0501047_0006676 3300049581 Bacteria 10845
95 Ga0501047_0468719 3300049581 Bacteria 1088
96 Ga0501266_016468 3300049763 Bacteria 982
97 Ga0501035_0168497 3300049822 Bacteria 1893
98 nmdc:mga08y16_252817_c1 3300050511 Bacteria 1821
99 Ga0500643_000526 3300053087 Bacteria 26972
100 Ga0500646_0000056 3300053090 Bacteria 30983
101 Ga0500556_0000756 3300053104 Bacteria 19286
102 Ga0500595_020062 3300053119 Bacteria 2413
103 Ga0500559_0009643 3300053136 Bacteria 4169
104 Ga0500616_0000113 3300053153 Bacteria 150722
105 Ga0500645_002069 3300053730 Bacteria 9304
106 Ga0500645_021605 3300053730 Bacteria 1985
107 2509077726 2508501114 Bacteria 7082538
108 2535486167 2534681786 Bacteria 3308809
109 2566995505 2565956761 Bacteria 6601618
110 2586062460 2585427649 Bacteria 9053857
111 2616557562 2615840698 Bacteria 7319877
112 2643762108 2643221548 Bacteria 8053412
113 2644387956 2643221670 Bacteria 6497041
114 2644411577 2643221674 Bacteria 3919126
115 2644459113 2643221682 Bacteria 6743283
116 2738888457 2738541308 Bacteria 7020677
117 2757569246 2757320392 Bacteria 3737298
118 2776373735 2775506925 Bacteria 7237746
119 2809588364 2808606522 Bacteria 9488490
120 2838030952 2838029111 Bacteria 6603031
121 2842477684 2842475841 Bacteria 6603183
122 2842504444 2842502639 Bacteria 6604161
123 2861692011 2861691609 Bacteria 5628931
124 2863070108 2863067949 Bacteria 8541735
125 2891329707 2891326441 Bacteria 6439512
126 2894818608 2894817345 Bacteria 4892941
127 2904537879 2904535858 Bacteria 6308016
128 2909044691 2909042592 Bacteria 6499737
129 2915775620 2915768154 Bacteria 8424322
130 2922557065 2922554459 Bacteria 6683962
131 2939659571 2939657138 Bacteria 3740283
132 2946078969 2946072368 Bacteria 8999607
133 3003930987 3003930520 Bacteria 5667563
134 8005688118 8005682033 Bacteria 6726518
135 8057347744 8057345674 Bacteria 4160394
136 Ga0466972_0083346
137 JGI24740J21852_10014894
138 JGI24740J21852_10038894
139 JGI24739J22299_10004789
140 JGI24737J22298_10012631
141 JGI24735J21928_10028988
142 rootH2_10015229
143 rootH1_10039424
144 rootH1_10063462
145 JGI25160J50197_1002375
146 Ga0065165_1005940
147 Ga0065165_1054507
148 Ga0070658_10667415
149 Ga0070670_100000116
150 Ga0070713_100120807
151 Ga0070706_100278010
152 Ga0070707_100497448
153 Ga0070698_100084306
154 Ga0070699_100003084
155 Ga0070699_100187045
156 Ga0070697_100047797
157 Ga0070697_100065685
158 Ga0068853_100194204
159 Ga0070696_100074768
160 Ga0070696_100433853
161 Ga0068852_100028721
162 Ga0075363_100076713
163 Ga0070716_100026760
164 Ga0070712_100322418
165 Ga0075369_10010773
166 Ga0099795_10033624
167 Ga0111539_10408643
168 Ga0105238_10501524
169 Ga0157374_10337003
170 Ga0157380_10285191
171 Ga0206352_10610635
172 Ga0209026_1003988
173 Ga0209130_1001508
174 Ga0207426_1001035
175 Ga0207692_10096634
176 Ga0207647_10015532
177 Ga0207671_10000203
178 Ga0207693_10227114
179 Ga0207700_10088675
180 Ga0207665_10026745
181 Ga0207665_10055578
182 Ga0207691_10442754
183 Ga0207640_10029982
184 Ga0209371_1002137
185 Ga0265337_1005180
186 Ga0265326_10006685
187 Ga0265319_1000542
188 Ga0265318_10002916
189 Ga0265322_10016691
190 Ga0265336_10000005
191 Ga0307515_10260116
192 Ga0265338_10000001
193 Ga0265324_10011434
194 Ga0265320_10026537
195 Ga0265340_10000001
196 Ga0265339_10168180
197 Ga0307508_10016315
198 Ga0307518_10001024
199 Ga0307407_10422779
200 Ga0307414_10458387
201 Ga0395900_0054730
202 Ga0395898_0059489
203 Ga0395905_0000281
204 Ga0436365_0842249
205 Ga0436365_1877132
206 Ga0439436_0005423
207 Ga0439439_0029130
208 Ga0451791_0905739
209 Ga0451793_0096708
210 Ga0439449_0016004
211 Ga0439457_001665
212 Ga0450906_002652
213 Ga0466963_0002335
214 Ga0453684_0094202
215 Ga0466970_0007275
216 Ga0466957_0341444
217 Ga0466967_0000204
218 Ga0495668_0001929
219 Ga0495668_0038391
220 Ga0495672_0009773
221 Ga0496108_0334185
222 Ga0496117_0001332
223 Ga0496122_0003472
224 Ga0496123_0020638
225 Ga0496125_0049704
226 Ga0501034_0003356
227 Ga0501034_0249255
228 Ga0501037_0047887
229 Ga0501047_0006676
230 Ga0501047_0468719
231 Ga0501266_016468
232 Ga0501035_0168497
233 nmdc:mga08y16_252817_c1
234 Ga0500643_000526
235 Ga0500646_0000056
236 Ga0500556_0000756
237 Ga0500595_020062
238 Ga0500559_0009643
239 Ga0500616_0000113
240 Ga0500645_002069
241 Ga0500645_021605
242 2509077726
243 2535486167
244 2566995505
245 2586062460
246 2616557562
247 2643762108
248 2644387956
249 2644411577
250 2644459113
251 2738888457
252 2757569246
253 2776373735
254 2809588364
255 2838030952
256 2842477684
257 2842504444
258 2861692011
259 2863070108
260 2891329707
261 2894818608
262 2904537879
263 2909044691
264 2915775620
265 2922557065
266 2939659571
267 2946078969
268 3003930987
269 8005688118
270 8057347744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

60

307

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a80-assembly1.cif.gz_A native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph 0.9855 1 269
1m9h-assembly1.cif.gz_A corynebacterium 2,5-dkgr a and phe 22 replaced with tyr (f22y), lys 232 replaced with gly (k232g), arg 238 replaced with his (r238h)and ala 272 replaced with gly (a272g)in presence of nadh cofactor 0.9849 1 269
4otk-assembly1.cif.gz_A a structural characterization of the isoniazid mycobacterium tuberculosis drug target, rv2971, in its unliganded form 0.9816 2 272
2wzt-assembly1.cif.gz_B crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form 0.9806 2 257
2wzm-assembly2.cif.gz_B crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form 0.979 1 272
ID Description Score Start End Superfamily
af_Q2G2T8_4_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9906 3 271 3.20.20.100
2wzmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.979 1 272 3.20.20.100
af_Q4DJ07_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9771 2 269 3.20.20.100
2wzmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9755 1 272 3.20.20.100
af_Q2FXE2_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9748 3 269 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A0K8PPL1-F1-model_v4 Oxidoreductase 1.004 2 122 GO:0004033
AF-A0A6B3FM37-F1-model_v4 Aldo/keto reductase 1.003 17 131 GO:0004033
GO:0044281
AF-U2Q8H5-F1-model_v4 Oxidoreductase, aldo/keto reductase domain protein 1.001 1 106 GO:0004033
GO:0044281
AF-A0A6B3GCP6-F1-model_v4 Aldo/keto reductase 1 2 160 GO:0004033
GO:0044281
AF-A0A8A6KK92-F1-model_v4 deleted 1 1 112

Map