F148839

General Info

Members Datasets Scaffolds Average Seq Length
131 95 262 447

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100001327|Ga0075431_1000013276
Length 481
Sequence MDTPFPFLNGVESMNEKAPKNPSMDSLEKQIDAWRAHLTKSRAISGSDVRELEDHLREQIASLTAQGLSEDEAFLVAVKRMGAIDDLTREFAREHSERLWKQLVLSREGGDRGTESAATNGSRKMWVAIGLAVLAGIAIKIPALFGMPFAENKSEAFYQLNMGFFILPFIAAYFALDRPLPKSATLWLAAVFVLSAIVVNAFPFYPTRGAHTHFLTSLHLPIALWLGVGMAYVGGRWRGNDRRMDFVRFTGELFIYCVLIALGGGVLTALTIQLFKAIGINVEPLAQNWIVPCGIAGAAVIAMWLVEAKQSVIENMAPVLTRIFAPLFGLMLITFVMTMVLTGRGIGADREILIAFDLLLVVVFGLLLYSISARDFLAPPGLFDWIQLILVVTALVVDVLALWAIATRISEFGFTPNRVAALGENIVLLINLAVSVVLYARFVRGGVAFSRLCNWQTFYLYVFAAWAAVVAFIFPLIFGFV

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
7 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
10 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
11 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
31 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
33 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
34 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
35 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
43 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
44 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
48 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
49 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
56 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
57 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
58 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
59 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
65 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
66 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
67 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
68 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
69 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
70 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
71 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
72 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
73 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
74 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
75 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
76 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
77 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
78 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
79 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
80 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
81 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
82 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
83 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
84 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
85 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
86 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
88 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
89 2508501039 Frankia saprophytica CN3 Isolate Nodule
90 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
91 2687453737 Frankia sp. BMG5.36 Isolate Nodule
92 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
93 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
94 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
95 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.66
Metatranscriptomes 0
Isolates 5.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.05
Nodule 3.05
Rhizoplane 0
Rhizosphere 86.26
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100001327 3300006847 Bacteria 22616
2 JGI25406J46586_10006464 3300003203 Bacteria 5392
3 JGI25406J46586_10013615 3300003203 Bacteria 3485
4 Ga0070669_100025621 3300005353 Bacteria 4237
5 Ga0070700_100125517 3300005441 Bacteria 1725
6 Ga0070662_100000431 3300005457 Bacteria 24792
7 Ga0070685_10000565 3300005466 Bacteria 20741
8 Ga0070685_10004251 3300005466 Bacteria 7224
9 Ga0070695_100014433 3300005545 Bacteria 4762
10 Ga0068857_100049453 3300005577 Bacteria 3730
11 Ga0068861_100038079 3300005719 Bacteria 3578
12 Ga0068861_100081915 3300005719 Bacteria 2528
13 Ga0068862_100043602 3300005844 Bacteria 3825
14 Ga0081540_1005301 3300005983 Bacteria 9647
15 Ga0081539_10000039 3300005985 Bacteria 295914
16 Ga0081539_10000100 3300005985 Bacteria 199516
17 Ga0081539_10002328 3300005985 Bacteria 27352
18 Ga0075428_100000026 3300006844 Bacteria 124176
19 Ga0075428_100000907 3300006844 Bacteria 31284
20 Ga0075428_100007736 3300006844 Bacteria 11909
21 Ga0075430_100002104 3300006846 Bacteria 16462
22 Ga0075430_100019399 3300006846 Bacteria 5782
23 Ga0075431_100158128 3300006847 Bacteria 2331
24 Ga0075431_100172189 3300006847 Bacteria 2224
25 Ga0075431_100173331 3300006847 Bacteria 2216
26 Ga0075433_10065834 3300006852 Unclassified 3179
27 Ga0075429_100001533 3300006880 Bacteria 18964
28 Ga0075429_100014654 3300006880 Bacteria 6797
29 Ga0111539_10005227 3300009094 Bacteria 16816
30 Ga0114129_10032649 3300009147 Bacteria 7355
31 Ga0105248_10000351 3300009177 Bacteria 53890
32 Ga0105246_10205122 3300011119 Bacteria 1535
33 Ga0157380_10021229 3300014326 Bacteria 4868
34 Ga0157380_10028506 3300014326 Bacteria 4258
35 Ga0207650_10010164 3300025925 Bacteria 6448
36 Ga0207706_10000412 3300025933 Bacteria 45835
37 Ga0207711_10000285 3300025941 Bacteria 53872
38 Ga0207689_10145241 3300025942 Bacteria 1954
39 Ga0207708_10088766 3300026075 Bacteria 2382
40 Ga0207674_10055924 3300026116 Bacteria 4008
41 Ga0207675_100002218 3300026118 Bacteria 19299
42 Ga0209974_10009465 3300027876 Bacteria 3307
43 Ga0207428_10017521 3300027907 Bacteria 6143
44 Ga0268265_10005594 3300028380 Bacteria 8581
45 Ga0316579_10032790 3300031691 Bacteria 2383
46 Ga0316576_10012621 3300031727 Bacteria 5589
47 Ga0316576_10036608 3300031727 Bacteria 3508
48 Ga0307516_10010281 3300031730 Bacteria 10307
49 Ga0307516_10044844 3300031730 Bacteria 4372
50 Ga0307516_10060453 3300031730 Bacteria 3681
51 Ga0307516_10194894 3300031730 Bacteria 1749
52 Ga0307405_10123867 3300031731 Bacteria 1774
53 Ga0307410_10012425 3300031852 Bacteria 4925
54 Ga0307410_10131013 3300031852 Bacteria 1842
55 Ga0307407_10013957 3300031903 Bacteria 3917
56 Ga0307409_100070233 3300031995 Bacteria 2779
57 Ga0307416_100050188 3300032002 Bacteria 3324
58 Ga0307416_100116032 3300032002 Bacteria 2372
59 Ga0307411_10016884 3300032005 Bacteria 4142
60 Ga0307415_100060943 3300032126 Bacteria 2610
61 Ga0307415_100131183 3300032126 Bacteria 1897
62 Ga0316583_10001613 3300032133 Bacteria 7621
63 Ga0316583_10002398 3300032133 Bacteria 6481
64 Ga0373959_0000015 3300034820 Bacteria 43554
65 Ga0395899_0002912 3300037312 Bacteria 13751
66 Ga0395898_0141189 3300037466 Bacteria 2306
67 Ga0395905_0063377 3300037471 Bacteria 3458
68 Ga0395905_0177250 3300037471 Bacteria 2001
69 Ga0395901_0002689 3300038443 Bacteria 17931
70 Ga0395901_0084086 3300038443 Bacteria 3326
71 Ga0466966_0008889 3300044684 Bacteria 6652
72 Ga0466963_0010860 3300044694 Bacteria 5530
73 Ga0453684_0003200 3300044712 Bacteria 37524
74 Ga0453684_0198480 3300044712 Bacteria 2340
75 Ga0466971_0034473 3300044719 Bacteria 2268
76 Ga0466957_0003375 3300044842 Bacteria 8768
77 Ga0466959_0005972 3300045049 Bacteria 8400
78 Ga0466958_0056661 3300045836 Bacteria 2381
79 Ga0495582_0009456 3300046473 Bacteria 5370
80 Ga0496117_0032734 3300048920 Bacteria 3945
81 Ga0496118_0004452 3300048921 Bacteria 16607
82 Ga0496126_0033086 3300048929 Bacteria 4866
83 Ga0501036_0042424 3300049572 Bacteria 3852
84 Ga0501038_0015614 3300049574 Bacteria 6903
85 Ga0501038_0134269 3300049574 Bacteria 2029
86 Ga0501042_0067356 3300049578 Bacteria 2559
87 Ga0501046_0074488 3300049580 Bacteria 2634
88 Ga0501048_0071233 3300049582 Bacteria 2454
89 Ga0501068_0034474 3300049584 Bacteria 3018
90 Ga0501068_0035398 3300049584 Bacteria 2980
91 Ga0501071_0139978 3300049587 Bacteria 1802
92 Ga0501072_0090198 3300049588 Bacteria 2433
93 Ga0501074_0004151 3300049590 Bacteria 10340
94 Ga0501074_0095900 3300049590 Bacteria 2124
95 Ga0501075_0185382 3300049591 Bacteria 1587
96 Ga0501076_0010502 3300049592 Bacteria 6873
97 Ga0501076_0017468 3300049592 Bacteria 5453
98 Ga0501077_0005760 3300049593 Bacteria 7549
99 Ga0501077_0036526 3300049593 Bacteria 3130
100 Ga0501079_0057285 3300049741 Bacteria 3007
101 Ga0501081_0095069 3300049743 Bacteria 2100
102 Ga0501045_0019985 3300049824 Bacteria 4780
103 nmdc:mga09592_181_c1 3300050508 Bacteria 44906
104 nmdc:mga0qj67_700_c1 3300050509 Bacteria 22844
105 nmdc:mga06r32_11281_c2 3300050510 Bacteria 3864
106 nmdc:mga06r32_15792_c1 3300050510 Bacteria 6864
107 nmdc:mga06r32_67_c1 3300050510 Bacteria 67231
108 nmdc:mga08y16_5376_c1 3300050511 Bacteria 13393
109 nmdc:mga0a205_69384_c1 3300050515 Unclassified 3403
110 Ga0500644_0031020 3300053088 Bacteria 1696
111 Ga0500646_0000466 3300053090 Bacteria 11946
112 Ga0500628_002227 3300053129 Bacteria 3234
113 Ga0500616_0045408 3300053153 Bacteria 2341
114 Ga0501084_0008047 3300054114 Bacteria 8681
115 Ga0501084_0012172 3300054114 Bacteria 7121
116 Ga0501084_0016179 3300054114 Bacteria 6194
117 Ga0501084_0135030 3300054114 Bacteria 2077
118 Ga0590071_006462 3300059421 Bacteria 2789
119 Ga0590074_004340 3300059423 Bacteria 2346
120 Ga0590075_008547 3300059424 Bacteria 2446
121 Ga0501082_0033344 3300060353 Bacteria 4443
122 Ga0501082_0055599 3300060353 Bacteria 3409
123 Ga0501082_0152801 3300060353 Bacteria 2005
124 Ga0530510_0062739 3300061734 Bacteria 2690
125 2508673036 2508501039 Bacteria 9978592
126 2676201911 2675902999 Bacteria 9438463
127 2689958292 2687453737 Bacteria 11203906
128 2842891007 2842888712 Bacteria 4279094
129 2929223142 2929219909 Bacteria 6984360
130 2996226533 2996221748 Bacteria 6799777
131 8055416922 8055412473 Bacteria 6257500
132 Ga0075431_100001327
133 JGI25406J46586_10006464
134 JGI25406J46586_10013615
135 Ga0070669_100025621
136 Ga0070700_100125517
137 Ga0070662_100000431
138 Ga0070685_10000565
139 Ga0070685_10004251
140 Ga0070695_100014433
141 Ga0068857_100049453
142 Ga0068861_100038079
143 Ga0068861_100081915
144 Ga0068862_100043602
145 Ga0081540_1005301
146 Ga0081539_10000039
147 Ga0081539_10000100
148 Ga0081539_10002328
149 Ga0075428_100000026
150 Ga0075428_100000907
151 Ga0075428_100007736
152 Ga0075430_100002104
153 Ga0075430_100019399
154 Ga0075431_100158128
155 Ga0075431_100172189
156 Ga0075431_100173331
157 Ga0075433_10065834
158 Ga0075429_100001533
159 Ga0075429_100014654
160 Ga0111539_10005227
161 Ga0114129_10032649
162 Ga0105248_10000351
163 Ga0105246_10205122
164 Ga0157380_10021229
165 Ga0157380_10028506
166 Ga0207650_10010164
167 Ga0207706_10000412
168 Ga0207711_10000285
169 Ga0207689_10145241
170 Ga0207708_10088766
171 Ga0207674_10055924
172 Ga0207675_100002218
173 Ga0209974_10009465
174 Ga0207428_10017521
175 Ga0268265_10005594
176 Ga0316579_10032790
177 Ga0316576_10012621
178 Ga0316576_10036608
179 Ga0307516_10010281
180 Ga0307516_10044844
181 Ga0307516_10060453
182 Ga0307516_10194894
183 Ga0307405_10123867
184 Ga0307410_10012425
185 Ga0307410_10131013
186 Ga0307407_10013957
187 Ga0307409_100070233
188 Ga0307416_100050188
189 Ga0307416_100116032
190 Ga0307411_10016884
191 Ga0307415_100060943
192 Ga0307415_100131183
193 Ga0316583_10001613
194 Ga0316583_10002398
195 Ga0373959_0000015
196 Ga0395899_0002912
197 Ga0395898_0141189
198 Ga0395905_0063377
199 Ga0395905_0177250
200 Ga0395901_0002689
201 Ga0395901_0084086
202 Ga0466966_0008889
203 Ga0466963_0010860
204 Ga0453684_0003200
205 Ga0453684_0198480
206 Ga0466971_0034473
207 Ga0466957_0003375
208 Ga0466959_0005972
209 Ga0466958_0056661
210 Ga0495582_0009456
211 Ga0496117_0032734
212 Ga0496118_0004452
213 Ga0496126_0033086
214 Ga0501036_0042424
215 Ga0501038_0015614
216 Ga0501038_0134269
217 Ga0501042_0067356
218 Ga0501046_0074488
219 Ga0501048_0071233
220 Ga0501068_0034474
221 Ga0501068_0035398
222 Ga0501071_0139978
223 Ga0501072_0090198
224 Ga0501074_0004151
225 Ga0501074_0095900
226 Ga0501075_0185382
227 Ga0501076_0010502
228 Ga0501076_0017468
229 Ga0501077_0005760
230 Ga0501077_0036526
231 Ga0501079_0057285
232 Ga0501081_0095069
233 Ga0501045_0019985
234 nmdc:mga09592_181_c1
235 nmdc:mga0qj67_700_c1
236 nmdc:mga06r32_11281_c2
237 nmdc:mga06r32_15792_c1
238 nmdc:mga06r32_67_c1
239 nmdc:mga08y16_5376_c1
240 nmdc:mga0a205_69384_c1
241 Ga0500644_0031020
242 Ga0500646_0000466
243 Ga0500628_002227
244 Ga0500616_0045408
245 Ga0501084_0008047
246 Ga0501084_0012172
247 Ga0501084_0016179
248 Ga0501084_0135030
249 Ga0590071_006462
250 Ga0590074_004340
251 Ga0590075_008547
252 Ga0501082_0033344
253 Ga0501082_0055599
254 Ga0501082_0152801
255 Ga0530510_0062739
256 2508673036
257 2676201911
258 2689958292
259 2842891007
260 2929223142
261 2996226533
262 8055416922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lfd-assembly1.cif.gz_A solution nmr structure of diiron protein in presence of 2 eq zn2+, northeast structural genomics consortium target or21 0.5971 320 443
2lfd-assembly1.cif.gz_A solution nmr structure of diiron protein in presence of 2 eq zn2+, northeast structural genomics consortium target or21 0.5782 320 443
1ktm-assembly1.cif.gz_A solution structure of fat domain of focal adhesion kinase 0.5744 322 445
7wux-assembly1.cif.gz_D crystal structure of aziu3/u2 complexed with (5s,6s)-o7-sulfo dadh from streptomyces sahachiroi 0.5664 332 444
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5241 298 409
ID Description Score Start End Superfamily
af_E7FDH3_673_793_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6745 326 441 1.20.120.230
af_Q2FZ34_110_392_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6693 357 442 3.40.630.30
af_Q2FZ34_165_379_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6693 357 442 3.40.630.30
af_P26039_786_909_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.667 329 443 1.20.120.230
af_D3ZA84_789_912_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6265 313 440 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A7K1ZJU9-F1-model_v4 DUF4153 domain-containing protein 0.9883 93 454 GO:0016020
AF-A0A7W1PFF3-F1-model_v4 DUF4153 domain-containing protein 0.9719 146 454 GO:0016020
AF-A0A7W1PFF3-F1-model_v4 DUF4153 domain-containing protein 0.9658 146 454 GO:0016020
AF-A0A2T4CN15-F1-model_v4 Uncharacterized protein 0.964 303 454 GO:0016020
AF-A0A7K1ZJU9-F1-model_v4 DUF4153 domain-containing protein 0.962 93 454 GO:0016020

Map