F148218

General Info

Members Datasets Scaffolds Average Seq Length
131 96 131 87

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_101529943|Ga0070674_1015299431
Length 103
Sequence MKLETFQQHRTSNLEPQTMTEAFESAVARSKEFTKRPSNEELLQLYALYKQATEGDVSGDRPGGFDFKAIAKFDAWEELKGKSTEQAEKEYIQLVDTLQQQYR

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
44 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
45 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
48 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
49 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
50 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
51 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
52 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
53 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
60 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
61 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
62 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
63 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
66 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
67 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
68 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
69 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
70 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
71 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
72 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
73 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
74 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
75 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
76 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
77 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
78 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
79 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
80 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
81 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
82 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
83 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
85 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
86 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
87 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
88 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
89 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
90 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
91 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
92 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
93 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
94 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
95 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
96 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.08
Nodule 0
Rhizoplane 2.29
Rhizosphere 59.54
Stem 0
Stem Tuber 0
Unclassified 19.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10000428 3300003316 Bacteria 39625
2 rootH1_10031513 3300003316 Bacteria 3364
3 rootH2_10029927 3300003320 Bacteria 24231
4 rootL2_10010208 3300003322 Bacteria 12601
5 rootL2_10021457 3300003322 Bacteria 12030
6 rootL2_10048177 3300003322 Bacteria 1743
7 rootL2_10079161 3300003322 Bacteria 12315
8 rootL2_10353978 3300003322 Unclassified 1417
9 rootH1_10001325 3300003323 Bacteria 38210
10 rootH1_10017455 3300003323 Bacteria 20752
11 rootH1_10035538 3300003323 Bacteria 6556
12 rootH1_10065583 3300003323 Bacteria 19600
13 rootH1_10154127 3300003323 Bacteria 1111
14 rootH1_10189033 3300003323 Bacteria 2935
15 rootH1_10229488 3300003323 Bacteria 3062
16 Ga0055530_10061011 3300003791 Bacteria 841
17 Ga0055531_10000359 3300003794 Bacteria 44255
18 Ga0058859_11249674 3300004798 Bacteria 663
19 Ga0065165_1007403 3300005262 Bacteria 5408
20 Ga0070671_100868147 3300005355 Bacteria 787
21 Ga0070674_101529943 3300005356 Bacteria 600
22 Ga0070701_10762843 3300005438 Bacteria 656
23 Ga0070663_100376579 3300005455 Bacteria 1155
24 Ga0068855_100166923 3300005563 Bacteria 2495
25 Ga0068857_101298097 3300005577 Bacteria 706
26 Ga0068856_100683142 3300005614 Bacteria 1047
27 Ga0068856_101572077 3300005614 Bacteria 671
28 Ga0068864_100137427 3300005618 Bacteria 2202
29 Ga0068863_100741892 3300005841 Unclassified 977
30 Ga0081455_10173200 3300005937 Bacteria 1641
31 Ga0070716_100114963 3300006173 Unclassified 1674
32 Ga0075428_100015368 3300006844 Bacteria 8489
33 Ga0075428_100182657 3300006844 Bacteria 2270
34 Ga0075430_100344627 3300006846 Bacteria 1230
35 Ga0075431_101490812 3300006847 Bacteria 635
36 Ga0075429_101896414 3300006880 Bacteria 516
37 Ga0111539_10011414 3300009094 Bacteria 11151
38 Ga0111539_10171363 3300009094 Bacteria 2536
39 Ga0111539_11341938 3300009094 Bacteria 830
40 Ga0114129_12921638 3300009147 Unclassified 564
41 Ga0105249_11816062 3300009553 Bacteria 682
42 Ga0157370_10833058 3300013104 Bacteria 839
43 Ga0157378_12210271 3300013297 Bacteria 601
44 Ga0157380_10010041 3300014326 Bacteria 6795
45 Ga0157380_10313638 3300014326 Bacteria 1451
46 Ga0157380_10347562 3300014326 Bacteria 1386
47 Ga0206352_11275536 3300020078 Eukaryota 642
48 Ga0209455_1014944 3300025272 Bacteria 1730
49 Ga0209050_1018760 3300025298 Bacteria 2667
50 Ga0209050_1022203 3300025298 Bacteria 2280
51 Ga0209257_1000005 3300025304 Bacteria 1592528
52 Ga0209257_1048034 3300025304 Bacteria 1223
53 Ga0207644_11499486 3300025931 Bacteria 566
54 Ga0207667_10185823 3300025949 Bacteria 2133
55 Ga0207702_10583688 3300026078 Bacteria 1096
56 Ga0207641_10728575 3300026088 Unclassified 978
57 Ga0207674_11953401 3300026116 Unclassified 552
58 Ga0207428_10540001 3300027907 Bacteria 844
59 Ga0307515_10058354 3300028794 Bacteria 5560
60 Ga0307515_10398629 3300028794 Bacteria 1002
61 Ga0307515_10546269 3300028794 Bacteria 768
62 Ga0265327_10113413 3300031251 Bacteria 1292
63 Ga0307513_10509553 3300031456 Bacteria 920
64 Ga0307509_10102688 3300031507 Bacteria 2890
65 Ga0307508_10591042 3300031616 Bacteria 711
66 Ga0307413_10278489 3300031824 Bacteria 1257
67 Ga0307414_11122004 3300032004 Bacteria 727
68 Ga0373927_0010342 3300035695 Bacteria 6228
69 Ga0373927_1149733 3300035695 Bacteria 512
70 Ga0373937_0699951 3300036401 Bacteria 960
71 Ga0451791_0918979 3300041451 Unclassified 534
72 Ga0451793_1884811 3300041452 Bacteria 519
73 Ga0451807_0065163 3300041486 Bacteria 625
74 Ga0451833_1383063 3300041491 Bacteria 597
75 Ga0451849_0150783 3300041505 Bacteria 1246
76 Ga0451853_3609530 3300041512 Unclassified 1069
77 Ga0451577_0035518 3300042876 Bacteria 4489
78 Ga0466964_0045523 3300044706 Bacteria 1786
79 Ga0453684_0003678 3300044712 Bacteria 34020
80 Ga0453684_2490126 3300044712 Unclassified 511
81 Ga0451576_0050403 3300045051 Bacteria 4366
82 Ga0451576_0316035 3300045051 Bacteria 1634
83 Ga0451576_1730252 3300045051 Bacteria 647
84 Ga0495592_0876538 3300046454 Unclassified 529
85 Ga0495638_0000015 3300046460 Bacteria 414645
86 Ga0495608_0577759 3300046511 Unclassified 676
87 Ga0495586_0342889 3300046535 Bacteria 858
88 Ga0495645_0281745 3300046543 Bacteria 1093
89 Ga0495625_0074596 3300046660 Unclassified 2376
90 Ga0495604_0894079 3300047317 Unclassified 555
91 Ga0501290_074008 3300049513 Unclassified 570
92 Ga0501298_120610 3300049521 Unclassified 617
93 Ga0501198_022225 3300049649 Bacteria 1015
94 Ga0501202_005801 3300049652 Bacteria 2193
95 Ga0501206_057854 3300049653 Unclassified 631
96 Ga0501210_000626 3300049657 Bacteria 1750
97 Ga0501217_002509 3300049661 Bacteria 3622
98 Ga0501236_002412 3300049670 Bacteria 2146
99 Ga0501247_048762 3300049677 Bacteria 623
100 Ga0501253_202599 3300049683 Bacteria 524
101 Ga0501257_001539 3300049686 Bacteria 4811
102 Ga0501257_003702 3300049686 Bacteria 3301
103 Ga0501257_065594 3300049686 Bacteria 922
104 Ga0501259_011171 3300049688 Bacteria 1480
105 Ga0501225_0110778 3300049705 Unclassified 809
106 Ga0501245_159788 3300049708 Unclassified 504
107 Ga0501264_000447 3300049761 Bacteria 6290
108 Ga0501266_020830 3300049763 Bacteria 894
109 nmdc:mga09592_1645805_c1 3300050508 Bacteria 519
110 nmdc:mga09592_1682067_c1 3300050508 Bacteria 512
111 nmdc:mga0qj67_466727_c1 3300050509 Unclassified 1016
112 nmdc:mga08y16_10405_c1 3300050511 Bacteria 9758
113 nmdc:mga08y16_498549_c1 3300050511 Bacteria 1237
114 nmdc:mga08y16_8156_c1 3300050511 Bacteria 10958
115 Ga0500578_0472428 3300053086 Bacteria 710
116 Ga0500644_0004324 3300053088 Bacteria 3549
117 Ga0500583_0228427 3300053092 Bacteria 922
118 Ga0500583_0514092 3300053092 Bacteria 561
119 Ga0500651_0683841 3300053093 Bacteria 550
120 Ga0500650_0465126 3300053098 Bacteria 541
121 Ga0500556_0165578 3300053104 Bacteria 873
122 Ga0500642_0343695 3300053130 Unclassified 664
123 Ga0500655_042925 3300053133 Unclassified 890
124 Ga0500655_053527 3300053133 Bacteria 806
125 Ga0500604_0009011 3300053151 Bacteria 2655
126 Ga0500616_0000043 3300053153 Bacteria 342930
127 Ga0500616_0022589 3300053153 Bacteria 3511
128 Ga0500622_0000115 3300053156 Bacteria 83078
129 Ga0500622_0001018 3300053156 Bacteria 23542
130 Ga0500622_0005089 3300053156 Bacteria 7995
131 Ga0500627_0245831 3300053158 Bacteria 793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0074596 Ga0495625_0074596_1692_1946 81
2 3300006844 Ga0075428_100182657 Ga0075428_1001826572 82
3 3300009094 Ga0111539_10171363 Ga0111539_101713632 82
4 3300009094 Ga0111539_11341938 Ga0111539_113419381 82
5 3300014326 Ga0157380_10010041 Ga0157380_100100413 82
6 3300027907 Ga0207428_10540001 Ga0207428_105400012 82
7 3300050508 nmdc:mga09592_1682067_c1 nmdc:mga09592_1682067_c1_66_323 82
8 3300050511 nmdc:mga08y16_10405_c1 nmdc:mga08y16_10405_c1_7561_7818 82
9 3300050511 nmdc:mga08y16_498549_c1 nmdc:mga08y16_498549_c1_927_1184 82
10 3300003322 rootL2_10021457 rootL2_100214576 83
11 3300003791 Ga0055530_10061011 Ga0055530_100610111 83
12 3300005355 Ga0070671_100868147 Ga0070671_1008681472 83
13 3300005455 Ga0070663_100376579 Ga0070663_1003765792 83
14 3300005577 Ga0068857_101298097 Ga0068857_1012980971 83
15 3300006844 Ga0075428_100015368 Ga0075428_1000153683 83
16 3300006846 Ga0075430_100344627 Ga0075430_1003446272 83
17 3300006847 Ga0075431_101490812 Ga0075431_1014908121 83
18 3300006880 Ga0075429_101896414 Ga0075429_1018964141 83
19 3300009094 Ga0111539_10011414 Ga0111539_100114147 83
20 3300009147 Ga0114129_12921638 Ga0114129_129216381 83
21 3300013104 Ga0157370_10833058 Ga0157370_108330581 83
22 3300014326 Ga0157380_10313638 Ga0157380_103136381 83
23 3300014326 Ga0157380_10347562 Ga0157380_103475623 83
24 3300025298 Ga0209050_1018760 Ga0209050_10187604 83
25 3300025298 Ga0209050_1022203 Ga0209050_10222032 83
26 3300025304 Ga0209257_1048034 Ga0209257_10480343 83
27 3300025931 Ga0207644_11499486 Ga0207644_114994861 83
28 3300031824 Ga0307413_10278489 Ga0307413_102784892 83
29 3300041512 Ga0451853_3609530 Ga0451853_3609530_87_347 83
30 3300046460 Ga0495638_0000015 Ga0495638_0000015_317713_317973 83
31 3300050508 nmdc:mga09592_1645805_c1 nmdc:mga09592_1645805_c1_42_302 83
32 3300050509 nmdc:mga0qj67_466727_c1 nmdc:mga0qj67_466727_c1_81_341 83
33 3300050511 nmdc:mga08y16_8156_c1 nmdc:mga08y16_8156_c1_10156_10416 83
34 3300053093 Ga0500651_0683841 Ga0500651_0683841_233_493 83
35 3300053098 Ga0500650_0465126 Ga0500650_0465126_101_361 83
36 3300053104 Ga0500556_0165578 Ga0500556_0165578_81_341 83
37 3300053153 Ga0500616_0000043 Ga0500616_0000043_115126_115386 83
38 3300003316 rootH1_10000428 rootH1_100004288 84
39 3300003316 rootH1_10031513 rootH1_100315132 84
40 3300003320 rootH2_10029927 rootH2_100299276 84
41 3300003322 rootL2_10010208 rootL2_100102088 84
42 3300003322 rootL2_10048177 rootL2_100481772 84
43 3300003322 rootL2_10079161 rootL2_100791614 84
44 3300003322 rootL2_10353978 rootL2_103539781 84
45 3300003323 rootH1_10001325 rootH1_1000132536 84
46 3300003323 rootH1_10017455 rootH1_100174555 84
47 3300003323 rootH1_10035538 rootH1_100355386 84
48 3300003323 rootH1_10065583 rootH1_100655833 84
49 3300003323 rootH1_10154127 rootH1_101541271 84
50 3300003323 rootH1_10189033 rootH1_101890332 84
51 3300003323 rootH1_10229488 rootH1_102294884 84
52 3300003794 Ga0055531_10000359 Ga0055531_1000035936 84
53 3300004798 Ga0058859_11249674 Ga0058859_112496741 84
54 3300005262 Ga0065165_1007403 Ga0065165_10074033 84
55 3300005356 Ga0070674_101529943 Ga0070674_1015299431 84
56 3300005438 Ga0070701_10762843 Ga0070701_107628431 84
57 3300005563 Ga0068855_100166923 Ga0068855_1001669233 84
58 3300005614 Ga0068856_100683142 Ga0068856_1006831422 84
59 3300005614 Ga0068856_101572077 Ga0068856_1015720772 84
60 3300005618 Ga0068864_100137427 Ga0068864_1001374272 84
61 3300005841 Ga0068863_100741892 Ga0068863_1007418922 84
62 3300005937 Ga0081455_10173200 Ga0081455_101732003 84
63 3300006173 Ga0070716_100114963 Ga0070716_1001149631 84
64 3300009553 Ga0105249_11816062 Ga0105249_118160622 84
65 3300013297 Ga0157378_12210271 Ga0157378_122102711 84
66 3300020078 Ga0206352_11275536 Ga0206352_112755361 84
67 3300025272 Ga0209455_1014944 Ga0209455_10149442 84
68 3300025304 Ga0209257_1000005 Ga0209257_10000051059 84
69 3300025949 Ga0207667_10185823 Ga0207667_101858233 84
70 3300026078 Ga0207702_10583688 Ga0207702_105836881 84
71 3300026088 Ga0207641_10728575 Ga0207641_107285751 84
72 3300026116 Ga0207674_11953401 Ga0207674_119534012 84
73 3300028794 Ga0307515_10058354 Ga0307515_100583543 84
74 3300028794 Ga0307515_10398629 Ga0307515_103986292 84
75 3300028794 Ga0307515_10546269 Ga0307515_105462692 84
76 3300031251 Ga0265327_10113413 Ga0265327_101134132 84
77 3300031456 Ga0307513_10509553 Ga0307513_105095531 84
78 3300031507 Ga0307509_10102688 Ga0307509_101026881 84
79 3300031616 Ga0307508_10591042 Ga0307508_105910421 84
80 3300032004 Ga0307414_11122004 Ga0307414_111220042 84
81 3300035695 Ga0373927_0010342 Ga0373927_0010342_5931_6194 84
82 3300035695 Ga0373927_1149733 Ga0373927_1149733_200_463 84
83 3300036401 Ga0373937_0699951 Ga0373937_0699951_201_464 84
84 3300041451 Ga0451791_0918979 Ga0451791_0918979_73_336 84
85 3300041452 Ga0451793_1884811 Ga0451793_1884811_208_471 84
86 3300041486 Ga0451807_0065163 Ga0451807_0065163_154_411 84
87 3300041491 Ga0451833_1383063 Ga0451833_1383063_99_362 84
88 3300041505 Ga0451849_0150783 Ga0451849_0150783_946_1203 84
89 3300042876 Ga0451577_0035518 Ga0451577_0035518_1270_1533 84
90 3300044706 Ga0466964_0045523 Ga0466964_0045523_1398_1661 84
91 3300044712 Ga0453684_0003678 Ga0453684_0003678_10732_10995 84
92 3300044712 Ga0453684_2490126 Ga0453684_2490126_134_397 84
93 3300045051 Ga0451576_0050403 Ga0451576_0050403_3953_4216 84
94 3300045051 Ga0451576_0316035 Ga0451576_0316035_1209_1472 84
95 3300045051 Ga0451576_1730252 Ga0451576_1730252_273_536 84
96 3300046454 Ga0495592_0876538 Ga0495592_0876538_20_283 84
97 3300046511 Ga0495608_0577759 Ga0495608_0577759_236_499 84
98 3300046535 Ga0495586_0342889 Ga0495586_0342889_456_719 84
99 3300046543 Ga0495645_0281745 Ga0495645_0281745_469_732 84
100 3300047317 Ga0495604_0894079 Ga0495604_0894079_224_487 84
101 3300049513 Ga0501290_074008 Ga0501290_074008_173_436 84
102 3300049521 Ga0501298_120610 Ga0501298_120610_187_450 84
103 3300049649 Ga0501198_022225 Ga0501198_022225_170_433 84
104 3300049652 Ga0501202_005801 Ga0501202_005801_566_829 84
105 3300049653 Ga0501206_057854 Ga0501206_057854_333_596 84
106 3300049657 Ga0501210_000626 Ga0501210_000626_1388_1651 84
107 3300049661 Ga0501217_002509 Ga0501217_002509_120_383 84
108 3300049670 Ga0501236_002412 Ga0501236_002412_451_714 84
109 3300049677 Ga0501247_048762 Ga0501247_048762_210_473 84
110 3300049683 Ga0501253_202599 Ga0501253_202599_140_403 84
111 3300049686 Ga0501257_001539 Ga0501257_001539_212_475 84
112 3300049686 Ga0501257_003702 Ga0501257_003702_2229_2492 84
113 3300049686 Ga0501257_065594 Ga0501257_065594_459_722 84
114 3300049688 Ga0501259_011171 Ga0501259_011171_1015_1278 84
115 3300049705 Ga0501225_0110778 Ga0501225_0110778_72_335 84
116 3300049708 Ga0501245_159788 Ga0501245_159788_107_370 84
117 3300049761 Ga0501264_000447 Ga0501264_000447_1530_1793 84
118 3300049763 Ga0501266_020830 Ga0501266_020830_333_596 84
119 3300053086 Ga0500578_0472428 Ga0500578_0472428_347_610 84
120 3300053088 Ga0500644_0004324 Ga0500644_0004324_1293_1556 84
121 3300053092 Ga0500583_0228427 Ga0500583_0228427_297_560 84
122 3300053092 Ga0500583_0514092 Ga0500583_0514092_287_550 84
123 3300053130 Ga0500642_0343695 Ga0500642_0343695_180_443 84
124 3300053133 Ga0500655_042925 Ga0500655_042925_546_809 84
125 3300053133 Ga0500655_053527 Ga0500655_053527_159_422 84
126 3300053151 Ga0500604_0009011 Ga0500604_0009011_1824_2087 84
127 3300053153 Ga0500616_0022589 Ga0500616_0022589_679_942 84
128 3300053156 Ga0500622_0000115 Ga0500622_0000115_73215_73478 84
129 3300053156 Ga0500622_0001018 Ga0500622_0001018_13698_13961 84
130 3300053156 Ga0500622_0005089 Ga0500622_0005089_4756_5019 84
131 3300053158 Ga0500627_0245831 Ga0500627_0245831_233_496 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00887

ACBP

Acyl CoA binding protein

20

95

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fj9-assembly1.cif.gz_A high resolution crystal structure of the unliganded human acbp 0.9949 4 82
1hb6-assembly1.cif.gz_A structure of bovine acyl-coa binding protein in orthorhombic crystal form 0.9858 4 82
2fdq-assembly3.cif.gz_C crystal structure of acbp from armadillo harderian gland 0.9847 4 82
5h3i-assembly3.cif.gz_C crystal structure of oryza sativa acyl-coa-binding protein 2 0.9718 3 82
5h3i-assembly1.cif.gz_A crystal structure of oryza sativa acyl-coa-binding protein 2 0.9682 3 82
ID Description Score Start End Superfamily
af_D3ZB36_1_88_1.20.80.10 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9899 1 82 1.20.80.10
af_P56702_1_86_1.20.80.10 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9881 6 82 1.20.80.10
2fdqB00 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9878 4 82 1.20.80.10
af_P42281_1_86_1.20.80.10 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9868 5 82 1.20.80.10
af_O75521_34_126_1.20.80.10 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9853 5 82 1.20.80.10
ID Description Score Start End GO Terms
AF-A0A3M6QPW0-F1-model_v4 Acyl-CoA-binding protein 1.004 2 83 GO:0000062
GO:0006631
AF-A0A3D5KP31-F1-model_v4 Acyl-CoA-binding protein 1.002 1 83 GO:0000062
GO:0006631
AF-H2XVM5-F1-model_v4 ACB domain-containing protein 0.9983 6 82 GO:0000062
GO:0006631
AF-A0A519S0E9-F1-model_v4 Acyl-CoA-binding protein 0.9981 19 82 GO:0000062
GO:0006631
AF-A0A2R7RYA8-F1-model_v4 ACB domain-containing protein 0.9977 2 82 GO:0000062
GO:0006631

Feature Viewer

pLDDT pTM Quality
95.71 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map