F146700

General Info

Members Datasets Scaffolds Average Seq Length
130 112 116 206

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0000134|Ga0495654_0000134_66726_67442
Length 238
Sequence MPETPAPDAWEIDMSSEPPAPREXXXXRPWLASEAEGQERKFAPAVSRNREAIASVLGGLLPVDGLVLELASGSGEHAVHFASLFPQLAWQPSDPDPHALASIEAWRNHAGPANLLAPLDLDAAAPVWPIKAADAVLCINMIHISPWASTSGLIAGAGRLLKSGQPLFLYGPFEQAGVETAASNIAFDQSLKARNPEWGLRRIEDVIALARQHGFDRQEIIPMPANNLFVALYVEDGR

Samples

Sample ID Description Type Environment
1 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
4 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
5 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
6 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
7 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
8 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
9 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
10 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
11 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
75 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
76 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
77 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
78 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
86 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
87 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
88 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
102 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
103 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
104 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
105 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
106 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
109 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
110 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
111 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
112 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.23
Metatranscriptomes 0
Isolates 10.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 3.08
Rhizoplane 0.77
Rhizosphere 80.77
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10084864 3300005295 Bacteria 6694
2 Ga0070658_10093687 3300005327 Bacteria 2477
3 Ga0070676_10021569 3300005328 Bacteria 3606
4 Ga0070670_100722815 3300005331 Bacteria 896
5 Ga0070677_10283808 3300005333 Unclassified 835
6 Ga0070680_100000131 3300005336 Bacteria 44894
7 Ga0070661_100204211 3300005344 Bacteria 1511
8 Ga0070668_100000027 3300005347 Bacteria 89913
9 Ga0070671_100004231 3300005355 Bacteria 11359
10 Ga0070667_100000017 3300005367 Bacteria 230531
11 Ga0070681_10000068 3300005458 Bacteria 75693
12 Ga0070679_100009851 3300005530 Bacteria 9040
13 Ga0070679_100210522 3300005530 Bacteria 1908
14 Ga0070672_100024466 3300005543 Bacteria 4464
15 Ga0068855_100018190 3300005563 Bacteria 8442
16 Ga0068857_100026431 3300005577 Bacteria 5116
17 Ga0068861_100475929 3300005719 Bacteria 1124
18 Ga0068858_100000103 3300005842 Bacteria 88754
19 Ga0068860_100000056 3300005843 Bacteria 202751
20 Ga0068862_100000520 3300005844 Bacteria 40702
21 Ga0075363_100155777 3300006048 Bacteria 1291
22 Ga0075364_10122211 3300006051 Bacteria 1743
23 Ga0111539_10102886 3300009094 Bacteria 3352
24 Ga0111539_10496541 3300009094 Unclassified 1421
25 Ga0105248_10383861 3300009177 Bacteria 1582
26 Ga0157372_10168057 3300013307 Bacteria 2537
27 Ga0163163_10425570 3300014325 Bacteria 1387
28 Ga0157376_10207907 3300014969 Unclassified 1805
29 Ga0207680_10032404 3300025903 Bacteria 2971
30 Ga0207645_10014635 3300025907 Bacteria 5241
31 Ga0207705_10113127 3300025909 Bacteria 2007
32 Ga0207707_10000002 3300025912 Bacteria 1142054
33 Ga0207660_10000230 3300025917 Bacteria 36015
34 Ga0207652_10000240 3300025921 Bacteria 57130
35 Ga0207652_10128227 3300025921 Bacteria 2261
36 Ga0207650_10017798 3300025925 Bacteria 4978
37 Ga0207644_10000066 3300025931 Bacteria 76450
38 Ga0207691_10003916 3300025940 Bacteria 14462
39 Ga0207667_10044167 3300025949 Bacteria 4724
40 Ga0207668_10000012 3300025972 Bacteria 182541
41 Ga0207658_10000011 3300025986 Bacteria 239620
42 Ga0207703_10000538 3300026035 Bacteria 38989
43 Ga0207641_10014644 3300026088 Bacteria 6430
44 Ga0207648_10167841 3300026089 Bacteria 1939
45 Ga0209974_10005032 3300027876 Bacteria 4675
46 Ga0268266_10000337 3300028379 Bacteria 73510
47 Ga0268265_10002075 3300028380 Bacteria 15633
48 Ga0268264_10000089 3300028381 Bacteria 234760
49 Ga0265338_10023727 3300028800 Bacteria 6292
50 Ga0265328_10011739 3300031239 Bacteria 3494
51 Ga0265331_10011822 3300031250 Bacteria 4764
52 Ga0265327_10014509 3300031251 Bacteria 5149
53 Ga0265316_10047259 3300031344 Bacteria 3405
54 Ga0307513_10418661 3300031456 Bacteria 1070
55 Ga0307413_10045443 3300031824 Bacteria 2603
56 Ga0307413_10256336 3300031824 Bacteria 1301
57 Ga0307410_10093708 3300031852 Bacteria 2137
58 Ga0307410_10147060 3300031852 Bacteria 1750
59 Ga0307410_10153290 3300031852 Bacteria 1718
60 Ga0307412_10078757 3300031911 Bacteria 2271
61 Ga0307412_10401183 3300031911 Bacteria 1116
62 Ga0307414_10042745 3300032004 Bacteria 3081
63 Ga0307414_11265705 3300032004 Bacteria 684
64 Ga0307411_10728187 3300032005 Bacteria 867
65 Ga0373937_0154579 3300036401 Bacteria 2150
66 Ga0395899_0159918 3300037312 Bacteria 1592
67 Ga0395900_0000293 3300037418 Bacteria 75318
68 Ga0395900_0093036 3300037418 Bacteria 3097
69 Ga0395898_0000219 3300037466 Bacteria 146838
70 Ga0395898_0024490 3300037466 Bacteria 6088
71 Ga0395905_0000094 3300037471 Bacteria 147776
72 Ga0395905_0377191 3300037471 Bacteria 1312
73 Ga0395905_1251815 3300037471 Bacteria 646
74 Ga0395901_0000228 3300038443 Bacteria 70677
75 Ga0395901_0016824 3300038443 Bacteria 7452
76 Ga0400483_063457 3300039062 Bacteria 1474
77 Ga0439466_0078652 3300041411 Bacteria 1042
78 Ga0451843_0582095 3300041509 Bacteria 1318
79 Ga0439448_0077752 3300042005 Unclassified 1111
80 Ga0439462_0001645 3300042015 Bacteria 5024
81 Ga0495610_0000213 3300046512 Bacteria 62796
82 Ga0495616_0090255 3300046513 Bacteria 1452
83 Ga0495643_0000054 3300046522 Bacteria 198757
84 Ga0495654_0000134 3300046530 Bacteria 77701
85 Ga0495615_0000097 3300048090 Bacteria 25034
86 Ga0496115_0052696 3300048918 Bacteria 3265
87 Ga0496122_0041809 3300048925 Bacteria 3616
88 Ga0496123_0017926 3300048926 Bacteria 5668
89 Ga0496124_0062651 3300048927 Bacteria 3111
90 Ga0496125_0080648 3300048928 Bacteria 2489
91 Ga0501032_0341582 3300049569 Bacteria 965
92 Ga0501036_0658331 3300049572 Bacteria 867
93 Ga0501039_0353581 3300049575 Bacteria 1154
94 Ga0501039_0608101 3300049575 Bacteria 857
95 Ga0501042_0150635 3300049578 Bacteria 1677
96 Ga0501046_0118836 3300049580 Bacteria 2013
97 Ga0501079_0135919 3300049741 Bacteria 1914
98 Ga0501035_0673090 3300049822 Unclassified 837
99 Ga0501044_0008524 3300049823 Bacteria 11234
100 Ga0501045_0016980 3300049824 Bacteria 5170
101 nmdc:mga08y16_347360_c1 3300050511 Bacteria 1524
102 nmdc:mga08y16_371916_c1 3300050511 Bacteria 1466
103 nmdc:mga08y16_534508_c1 3300050511 Unclassified 1188
104 nmdc:mga0n895_40794_c1 3300050512 Bacteria 4510
105 nmdc:mga0rr50_381075_c1 3300050513 Bacteria 1189
106 Ga0500643_000834 3300053087 Bacteria 19775
107 Ga0500641_0002773 3300053096 Bacteria 6198
108 Ga0500572_024833 3300053111 Bacteria 1621
109 Ga0500618_002646 3300053125 Bacteria 6592
110 Ga0500618_013436 3300053125 Bacteria 2114
111 Ga0500622_0059233 3300053156 Bacteria 1956
112 Ga0500645_000666 3300053730 Bacteria 21562
113 Ga0500645_005967 3300053730 Bacteria 4407
114 Ga0501084_0215693 3300054114 Bacteria 1619
115 Ga0501082_0346358 3300060353 Unclassified 1295
116 Ga0530510_0358153 3300061734 Bacteria 1096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10023727 Ga0265338_100237275 169
2 3300036401 Ga0373937_0154579 Ga0373937_0154579_1558_2109 175
3 3300048918 Ga0496115_0052696 Ga0496115_0052696_2206_2745 175
4 3300053730 Ga0500645_005967 Ga0500645_005967_70_609 175
5 3300053156 Ga0500622_0059233 Ga0500622_0059233_1091_1723 185
6 3300049569 Ga0501032_0341582 Ga0501032_0341582_153_800 192
7 3300049741 Ga0501079_0135919 Ga0501079_0135919_525_1172 192
8 iso_pu_bacteria 2595698237 2596372164 195
9 iso_pu_bacteria 2928125067 2928129112 195
10 3300042015 Ga0439462_0001645 Ga0439462_0001645_2302_2892 196
11 3300005327 Ga0070658_10093687 Ga0070658_100936874 197
12 3300005331 Ga0070670_100722815 Ga0070670_1007228152 197
13 3300005333 Ga0070677_10283808 Ga0070677_102838082 197
14 3300005563 Ga0068855_100018190 Ga0068855_1000181908 197
15 3300009094 Ga0111539_10496541 Ga0111539_104965412 197
16 3300013307 Ga0157372_10168057 Ga0157372_101680573 197
17 3300014969 Ga0157376_10207907 Ga0157376_102079072 197
18 3300025909 Ga0207705_10113127 Ga0207705_101131273 197
19 3300025949 Ga0207667_10044167 Ga0207667_100441677 197
20 3300031824 Ga0307413_10256336 Ga0307413_102563363 197
21 3300031852 Ga0307410_10147060 Ga0307410_101470602 197
22 3300031852 Ga0307410_10153290 Ga0307410_101532903 197
23 3300031911 Ga0307412_10078757 Ga0307412_100787573 197
24 3300032004 Ga0307414_10042745 Ga0307414_100427453 197
25 3300032004 Ga0307414_11265705 Ga0307414_112657051 197
26 3300050511 nmdc:mga08y16_534508_c1 nmdc:mga08y16_534508_c1_215_808 197
27 iso_pu_bacteria 2883577096 2883578792 197
28 3300005336 Ga0070680_100000131 Ga0070680_10000013112 198
29 3300005344 Ga0070661_100204211 Ga0070661_1002042112 198
30 3300005458 Ga0070681_10000068 Ga0070681_1000006820 198
31 3300005530 Ga0070679_100009851 Ga0070679_1000098511 198
32 3300025912 Ga0207707_10000002 Ga0207707_100000021134 198
33 3300025917 Ga0207660_10000230 Ga0207660_1000023030 198
34 3300025921 Ga0207652_10000240 Ga0207652_100002403 198
35 3300037471 Ga0395905_1251815 Ga0395905_1251815_10_615 198
36 3300039062 Ga0400483_063457 Ga0400483_063457_162_833 198
37 3300046512 Ga0495610_0000213 Ga0495610_0000213_51582_52196 198
38 3300046522 Ga0495643_0000054 Ga0495643_0000054_18491_19105 198
39 3300048925 Ga0496122_0041809 Ga0496122_0041809_1237_1884 198
40 3300048926 Ga0496123_0017926 Ga0496123_0017926_203_850 198
41 3300048927 Ga0496124_0062651 Ga0496124_0062651_1369_2016 198
42 3300053125 Ga0500618_002646 Ga0500618_002646_3747_4592 198
43 3300053125 Ga0500618_013436 Ga0500618_013436_36_881 198
44 iso_pu_bacteria 2513237165 2514043772 198
45 iso_pu_bacteria 2775507255 2778125061 198
46 iso_pu_bacteria 2808606401 2809062436 198
47 iso_pu_bacteria 2808606404 2809078224 198
48 iso_pu_bacteria 2808606405 2809082825 198
49 iso_pu_bacteria 2880518877 2880522304 198
50 iso_pu_bacteria 2919709256 2919709725 198
51 iso_pu_bacteria 644736347 644752164 198
52 iso_pu_bacteria 8054302542 8054304893 198
53 3300005295 Ga0065707_10084864 Ga0065707_100848644 199
54 3300005328 Ga0070676_10021569 Ga0070676_100215693 199
55 3300005347 Ga0070668_100000027 Ga0070668_10000002760 199
56 3300005355 Ga0070671_100004231 Ga0070671_1000042317 199
57 3300005367 Ga0070667_100000017 Ga0070667_100000017183 199
58 3300005530 Ga0070679_100210522 Ga0070679_1002105223 199
59 3300005543 Ga0070672_100024466 Ga0070672_1000244662 199
60 3300005577 Ga0068857_100026431 Ga0068857_1000264316 199
61 3300005719 Ga0068861_100475929 Ga0068861_1004759292 199
62 3300005842 Ga0068858_100000103 Ga0068858_10000010330 199
63 3300005843 Ga0068860_100000056 Ga0068860_10000005661 199
64 3300005844 Ga0068862_100000520 Ga0068862_10000052012 199
65 3300006048 Ga0075363_100155777 Ga0075363_1001557772 199
66 3300006051 Ga0075364_10122211 Ga0075364_101222112 199
67 3300009094 Ga0111539_10102886 Ga0111539_101028862 199
68 3300009177 Ga0105248_10383861 Ga0105248_103838612 199
69 3300014325 Ga0163163_10425570 Ga0163163_104255702 199
70 3300025903 Ga0207680_10032404 Ga0207680_100324043 199
71 3300025907 Ga0207645_10014635 Ga0207645_100146356 199
72 3300025921 Ga0207652_10128227 Ga0207652_101282272 199
73 3300025925 Ga0207650_10017798 Ga0207650_100177983 199
74 3300025931 Ga0207644_10000066 Ga0207644_1000006659 199
75 3300025940 Ga0207691_10003916 Ga0207691_100039163 199
76 3300025972 Ga0207668_10000012 Ga0207668_1000001259 199
77 3300025986 Ga0207658_10000011 Ga0207658_1000001160 199
78 3300026035 Ga0207703_10000538 Ga0207703_1000053812 199
79 3300026088 Ga0207641_10014644 Ga0207641_100146443 199
80 3300026089 Ga0207648_10167841 Ga0207648_101678413 199
81 3300027876 Ga0209974_10005032 Ga0209974_100050323 199
82 3300028379 Ga0268266_10000337 Ga0268266_1000033717 199
83 3300028380 Ga0268265_10002075 Ga0268265_100020757 199
84 3300028381 Ga0268264_10000089 Ga0268264_10000089190 199
85 3300031239 Ga0265328_10011739 Ga0265328_100117395 199
86 3300031250 Ga0265331_10011822 Ga0265331_100118224 199
87 3300031251 Ga0265327_10014509 Ga0265327_100145097 199
88 3300031344 Ga0265316_10047259 Ga0265316_100472593 199
89 3300031456 Ga0307513_10418661 Ga0307513_104186611 199
90 3300031824 Ga0307413_10045443 Ga0307413_100454432 199
91 3300031852 Ga0307410_10093708 Ga0307410_100937081 199
92 3300031911 Ga0307412_10401183 Ga0307412_104011832 199
93 3300032005 Ga0307411_10728187 Ga0307411_107281872 199
94 3300037312 Ga0395899_0159918 Ga0395899_0159918_572_1174 199
95 3300037418 Ga0395900_0000293 Ga0395900_0000293_10713_11348 199
96 3300037418 Ga0395900_0093036 Ga0395900_0093036_2417_3019 199
97 3300037466 Ga0395898_0000219 Ga0395898_0000219_107879_108514 199
98 3300037466 Ga0395898_0024490 Ga0395898_0024490_725_1327 199
99 3300037471 Ga0395905_0000094 Ga0395905_0000094_108817_109452 199
100 3300037471 Ga0395905_0377191 Ga0395905_0377191_561_1196 199
101 3300038443 Ga0395901_0000228 Ga0395901_0000228_10713_11348 199
102 3300038443 Ga0395901_0016824 Ga0395901_0016824_3344_3946 199
103 3300041411 Ga0439466_0078652 Ga0439466_0078652_76_696 199
104 3300041509 Ga0451843_0582095 Ga0451843_0582095_307_918 199
105 3300042005 Ga0439448_0077752 Ga0439448_0077752_417_1052 199
106 3300046513 Ga0495616_0090255 Ga0495616_0090255_48_653 199
107 3300046530 Ga0495654_0000134 Ga0495654_0000134_66726_67442 199
108 3300048090 Ga0495615_0000097 Ga0495615_0000097_12250_12855 199
109 3300048928 Ga0496125_0080648 Ga0496125_0080648_1402_2004 199
110 3300049572 Ga0501036_0658331 Ga0501036_0658331_59_694 199
111 3300049575 Ga0501039_0353581 Ga0501039_0353581_395_1042 199
112 3300049575 Ga0501039_0608101 Ga0501039_0608101_176_811 199
113 3300049578 Ga0501042_0150635 Ga0501042_0150635_218_865 199
114 3300049580 Ga0501046_0118836 Ga0501046_0118836_865_1512 199
115 3300049822 Ga0501035_0673090 Ga0501035_0673090_179_826 199
116 3300049823 Ga0501044_0008524 Ga0501044_0008524_10550_11167 199
117 3300049824 Ga0501045_0016980 Ga0501045_0016980_675_1322 199
118 3300050511 nmdc:mga08y16_347360_c1 nmdc:mga08y16_347360_c1_872_1510 199
119 3300050511 nmdc:mga08y16_371916_c1 nmdc:mga08y16_371916_c1_94_714 199
120 3300050512 nmdc:mga0n895_40794_c1 nmdc:mga0n895_40794_c1_2398_3018 199
121 3300050513 nmdc:mga0rr50_381075_c1 nmdc:mga0rr50_381075_c1_20_640 199
122 3300053087 Ga0500643_000834 Ga0500643_000834_11218_11844 199
123 3300053096 Ga0500641_0002773 Ga0500641_0002773_4091_4717 199
124 3300053111 Ga0500572_024833 Ga0500572_024833_698_1414 199
125 3300053730 Ga0500645_000666 Ga0500645_000666_9572_10198 199
126 3300054114 Ga0501084_0215693 Ga0501084_0215693_73_720 199
127 3300060353 Ga0501082_0346358 Ga0501082_0346358_548_1186 199
128 3300061734 Ga0530510_0358153 Ga0530510_0358153_58_696 199
129 iso_pu_bacteria 2513237166 2514049540 199
130 iso_pu_bacteria 642555112 642596462 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06080

DUF938

Protein of unknown function (DUF938)

40

233

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tjj-assembly1.cif.gz_A sam-dependent methyltransferase redm bound to sam 0.8796 9 198
8tjk-assembly1.cif.gz_A sam-dependent methyltransferase redm bound to sah 0.8786 9 198
8tji-assembly1.cif.gz_A sam-dependent methyltransferase redm, apo 0.875 9 198
8tji-assembly1.cif.gz_B sam-dependent methyltransferase redm, apo 0.8708 9 198
8tjj-assembly1.cif.gz_D sam-dependent methyltransferase redm bound to sam 0.8707 9 198
ID Description Score Start End Superfamily
af_Q7YWR7_1_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9624 5 198 3.40.50.150
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9557 6 197 3.40.50.150
af_Q66I74_7_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9488 11 178 3.40.50.150
af_Q9VLF6_13_218_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9473 4 194 3.40.50.150
af_Q7YWR7_1_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9342 5 198 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7C2YJB0-F1-model_v4 DUF938 domain-containing protein 0.9958 4 199
AF-A0A4Q6A702-F1-model_v4 deleted 0.9948 4 163
AF-A0A0S8EZW2-F1-model_v4 SAM-dependent methyltransferase 0.994 4 83 GO:0008168
GO:0032259
AF-A0A3B9UP37-F1-model_v4 deleted 0.9919 25 198
AF-A0A0H4VCM8-F1-model_v4 SAM-dependent methyltransferase 0.9901 4 199 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
95.61 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map