F143162

General Info

Members Datasets Scaffolds Average Seq Length
129 102 123 250

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0166387|Ga0496125_0166387_171_1019
Length 282
Sequence MIGVAGALFEPAALGLSEATRSPYLRGMLKRLFRSSVRTEQVAQPTIPPGRRVYAIGDIHGRLDLLDRLLAAIVTDARDRGEAQTTLIFLGDLIDRGPDSASVVERAIALSKSELDVRFIQGNHEEAFLAALKGTPGAMRFLLRIGGRETLESYGLDERDHPELDYDDLAELACQHVPEAHRTFLAGFEDMIAIGDYLFVHAGVRPGVHFDSQKASDLRWIREEFLDHAGSHGAIIVHGHTITDAVQVRDNRIGIDTGAFQSDCLTAIGLEGRERWFLDTAA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
4 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
21 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
22 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
23 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
24 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
28 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
41 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
42 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
43 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
64 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
65 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
66 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
78 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
92 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
93 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
94 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
95 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
96 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
97 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
98 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
99 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
100 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
101 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
102 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.38
Nodule 0
Rhizoplane 0.78
Rhizosphere 72.09
Stem 0
Stem Tuber 0
Unclassified 7.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10793118 2162886012 Bacteria 1233
2 MBSR1b_contig_1304737 2162886012 Bacteria 1183
3 JGI25165J46597_1000007 3300003214 Bacteria 518996
4 Ga0055530_10000142 3300003791 Bacteria 64055
5 Ga0055531_10000013 3300003794 Bacteria 187583
6 Ga0065715_10138552 3300005293 Bacteria 1890
7 Ga0070668_100005891 3300005347 Bacteria 9086
8 Ga0068853_100257336 3300005539 Bacteria 1604
9 Ga0068852_100297960 3300005616 Bacteria 1560
10 Ga0068864_100051565 3300005618 Bacteria 3545
11 Ga0068861_100290729 3300005719 Bacteria 1411
12 Ga0068858_100001870 3300005842 Bacteria 21482
13 Ga0075364_10295150 3300006051 Bacteria 1103
14 Ga0105240_10052212 3300009093 Bacteria 5140
15 Ga0111539_10299657 3300009094 Bacteria 1871
16 Ga0105245_10000253 3300009098 Bacteria 50973
17 Ga0105249_10322314 3300009553 Bacteria 1557
18 Ga0157378_10330268 3300013297 Bacteria 1484
19 Ga0163162_10312982 3300013306 Unclassified 1703
20 Ga0157380_10009206 3300014326 Bacteria 7066
21 Ga0157380_10601670 3300014326 Bacteria 1088
22 Ga0183363_1004 3300015690 Bacteria 416766
23 Ga0183361_11239 3300016635 Bacteria 1292
24 Ga0163161_10083545 3300017792 Bacteria 2354
25 Ga0213875_10004741 3300021388 Bacteria 7397
26 Ga0209233_1000026 3300025261 Bacteria 678466
27 Ga0209675_1010360 3300025291 Bacteria 3191
28 Ga0209050_1000014 3300025298 Bacteria 774327
29 Ga0209257_1000019 3300025304 Bacteria 774261
30 Ga0207697_10068225 3300025315 Bacteria 1488
31 Ga0207695_10027475 3300025913 Bacteria 6335
32 Ga0207687_10000449 3300025927 Bacteria 28037
33 Ga0207711_10062001 3300025941 Bacteria 3225
34 Ga0207668_10006811 3300025972 Bacteria 6771
35 Ga0207668_10281402 3300025972 Bacteria 1364
36 Ga0207703_10001126 3300026035 Bacteria 25229
37 Ga0207676_10037547 3300026095 Bacteria 3692
38 Ga0209974_10042285 3300027876 Bacteria 1517
39 Ga0268265_10254410 3300028380 Bacteria 1558
40 Ga0265324_10023448 3300029957 Bacteria 2198
41 Ga0265328_10040735 3300031239 Bacteria 1711
42 Ga0265340_10001738 3300031247 Bacteria 12491
43 Ga0265340_10121507 3300031247 Bacteria 1201
44 Ga0265339_10015492 3300031249 Bacteria 4568
45 Ga0265327_10003125 3300031251 Bacteria 16270
46 Ga0265316_10073106 3300031344 Bacteria 2641
47 Ga0265316_10076106 3300031344 Bacteria 2579
48 Ga0265316_10093562 3300031344 Bacteria 2290
49 Ga0307513_10314998 3300031456 Bacteria 1325
50 Ga0265313_10002267 3300031595 Bacteria 16896
51 Ga0307508_10001382 3300031616 Bacteria 27344
52 Ga0265342_10001249 3300031712 Bacteria 24001
53 Ga0307405_10045770 3300031731 Bacteria 2684
54 Ga0307413_10145013 3300031824 Bacteria 1646
55 Ga0307406_10135368 3300031901 Bacteria 1736
56 Ga0307406_10350471 3300031901 Bacteria 1153
57 Ga0307412_10178917 3300031911 Bacteria 1593
58 Ga0307416_100001979 3300032002 Bacteria 11488
59 Ga0307416_100417645 3300032002 Bacteria 1384
60 Ga0307414_10233342 3300032004 Bacteria 1518
61 Ga0307510_10006886 3300033180 Bacteria 13556
62 Ga0395899_0102515 3300037312 Bacteria 2065
63 Ga0395899_0351111 3300037312 Bacteria 986
64 Ga0395899_0351132 3300037312 Bacteria 986
65 Ga0395900_0838301 3300037418 Bacteria 845
66 Ga0395898_0145363 3300037466 Bacteria 2269
67 Ga0395898_0195547 3300037466 Unclassified 1932
68 Ga0395898_0211788 3300037466 Bacteria 1848
69 Ga0395905_0000762 3300037471 Bacteria 42402
70 Ga0395905_0116961 3300037471 Bacteria 2505
71 Ga0395905_0219356 3300037471 Unclassified 1780
72 Ga0436364_0056434 3300037853 Bacteria 7467
73 Ga0395901_0184791 3300038443 Unclassified 2186
74 Ga0395901_1007520 3300038443 Bacteria 808
75 Ga0439465_0000021 3300041413 Bacteria 32287
76 Ga0451793_0056641 3300041452 Bacteria 3168
77 Ga0439431_0002003 3300041997 Bacteria 4511
78 Ga0439445_0000025 3300042004 Bacteria 19816
79 Ga0466969_0017557 3300044656 Bacteria 3734
80 Ga0466966_0081016 3300044684 Bacteria 2021
81 Ga0466966_0465815 3300044684 Bacteria 760
82 Ga0466963_0005621 3300044694 Bacteria 7355
83 Ga0466963_0017663 3300044694 Bacteria 4448
84 Ga0466959_0011848 3300045049 Bacteria 6278
85 Ga0466958_0009462 3300045836 Bacteria 5431
86 Ga0466967_0284750 3300045976 Bacteria 1586
87 Ga0495638_0000228 3300046460 Bacteria 76924
88 Ga0495585_0135478 3300046492 Bacteria 1293
89 Ga0495583_0031044 3300046506 Bacteria 2595
90 Ga0495648_0010358 3300046524 Bacteria 7105
91 Ga0495648_0038951 3300046524 Bacteria 3032
92 Ga0495663_0008822 3300046525 Bacteria 2797
93 Ga0495663_0022198 3300046525 Bacteria 1832
94 Ga0495598_0016419 3300046537 Bacteria 1889
95 Ga0495625_0000054 3300046660 Bacteria 187599
96 Ga0495625_0009806 3300046660 Bacteria 7968
97 Ga0495625_0023897 3300046660 Bacteria 4661
98 Ga0495613_0001138 3300046689 Bacteria 20240
99 Ga0495670_0066792 3300046691 Bacteria 1815
100 Ga0495686_0014275 3300047472 Bacteria 5472
101 Ga0496121_0034997 3300048924 Bacteria 4508
102 Ga0496125_0166387 3300048928 Bacteria 1489
103 Ga0501034_0161116 3300049571 Bacteria 2214
104 Ga0501038_0678374 3300049574 Bacteria 774
105 Ga0501039_0590502 3300049575 Bacteria 871
106 Ga0501043_0265245 3300049579 Bacteria 1320
107 Ga0501047_0392234 3300049581 Bacteria 1222
108 Ga0501080_0385955 3300049742 Bacteria 1261
109 nmdc:mga00v17_260974_c1 3300050491 Bacteria 1124
110 nmdc:mga07m45_241904_c1 3300050496 Bacteria 1050
111 Ga0500643_000837 3300053087 Bacteria 19751
112 Ga0500641_0004156 3300053096 Bacteria 5111
113 Ga0500595_000725 3300053119 Bacteria 19606
114 Ga0500658_0005807 3300053134 Bacteria 4597
115 Ga0500559_0021384 3300053136 Bacteria 2742
116 Ga0500559_0048360 3300053136 Bacteria 1870
117 Ga0500559_0119372 3300053136 Bacteria 1225
118 Ga0500590_144700 3300053148 Bacteria 1081
119 Ga0500616_0009416 3300053153 Bacteria 5942
120 Ga0500616_0031164 3300053153 Bacteria 2922
121 Ga0500627_0003192 3300053158 Bacteria 5028
122 Ga0500645_002209 3300053730 Bacteria 8888
123 Ga0500552_012184 3300053733 Bacteria 1095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10000253 Ga0105245_1000025342 212
2 3300013297 Ga0157378_10330268 Ga0157378_103302682 212
3 3300013306 Ga0163162_10312982 Ga0163162_103129821 212
4 3300005618 Ga0068864_100051565 Ga0068864_1000515652 214
5 3300005719 Ga0068861_100290729 Ga0068861_1002907291 214
6 3300017792 Ga0163161_10083545 Ga0163161_100835452 214
7 3300025315 Ga0207697_10068225 Ga0207697_100682252 214
8 3300025941 Ga0207711_10062001 Ga0207711_100620011 214
9 3300026095 Ga0207676_10037547 Ga0207676_100375472 214
10 3300049575 Ga0501039_0590502 Ga0501039_0590502_17_667 214
11 3300031239 Ga0265328_10040735 Ga0265328_100407352 222
12 3300031247 Ga0265340_10001738 Ga0265340_100017386 222
13 3300031249 Ga0265339_10015492 Ga0265339_100154922 222
14 3300031344 Ga0265316_10076106 Ga0265316_100761063 222
15 3300031595 Ga0265313_10002267 Ga0265313_1000226715 222
16 3300031712 Ga0265342_10001249 Ga0265342_100012492 222
17 3300044684 Ga0466966_0465815 Ga0466966_0465815_64_747 226
18 3300014326 Ga0157380_10601670 Ga0157380_106016701 229
19 3300031247 Ga0265340_10121507 Ga0265340_101215071 234
20 3300049571 Ga0501034_0161116 Ga0501034_0161116_1006_1722 234
21 3300049574 Ga0501038_0678374 Ga0501038_0678374_29_745 234
22 3300049579 Ga0501043_0265245 Ga0501043_0265245_167_883 234
23 3300049742 Ga0501080_0385955 Ga0501080_0385955_512_1228 234
24 3300025291 Ga0209675_1010360 Ga0209675_10103602 235
25 3300021388 Ga0213875_10004741 Ga0213875_100047413 236
26 3300037853 Ga0436364_0056434 Ga0436364_0056434_1024_1788 236
27 3300049581 Ga0501047_0392234 Ga0501047_0392234_229_963 237
28 3300003791 Ga0055530_10000142 Ga0055530_1000014252 238
29 3300003794 Ga0055531_10000013 Ga0055531_1000001310 238
30 3300025298 Ga0209050_1000014 Ga0209050_1000014154 238
31 3300025304 Ga0209257_1000019 Ga0209257_1000019538 238
32 3300025913 Ga0207695_10027475 Ga0207695_100274752 242
33 iso_pu_bacteria 2522572158 2523103572 242
34 iso_pu_bacteria 2830075706 2830078609 242
35 iso_pu_bacteria 2903727486 2903728195 242
36 3300009093 Ga0105240_10052212 Ga0105240_100522122 243
37 3300053153 Ga0500616_0031164 Ga0500616_0031164_1935_2732 244
38 3300029957 Ga0265324_10023448 Ga0265324_100234483 246
39 3300031344 Ga0265316_10073106 Ga0265316_100731063 246
40 3300046524 Ga0495648_0010358 Ga0495648_0010358_3129_3878 246
41 3300048924 Ga0496121_0034997 Ga0496121_0034997_462_1256 246
42 3300053148 Ga0500590_144700 Ga0500590_144700_65_862 246
43 3300053733 Ga0500552_012184 Ga0500552_012184_272_1069 246
44 3300003214 JGI25165J46597_1000007 JGI25165J46597_1000007404 247
45 3300005539 Ga0068853_100257336 Ga0068853_1002573362 247
46 3300005616 Ga0068852_100297960 Ga0068852_1002979602 247
47 3300005842 Ga0068858_100001870 Ga0068858_10000187016 247
48 3300009553 Ga0105249_10322314 Ga0105249_103223142 247
49 3300025261 Ga0209233_1000026 Ga0209233_1000026402 247
50 3300025927 Ga0207687_10000449 Ga0207687_1000044918 247
51 3300025972 Ga0207668_10281402 Ga0207668_102814022 247
52 3300026035 Ga0207703_10001126 Ga0207703_100011268 247
53 3300031251 Ga0265327_10003125 Ga0265327_100031256 247
54 3300031344 Ga0265316_10093562 Ga0265316_100935622 247
55 3300031616 Ga0307508_10001382 Ga0307508_100013824 247
56 3300031731 Ga0307405_10045770 Ga0307405_100457702 247
57 3300031901 Ga0307406_10135368 Ga0307406_101353682 247
58 3300032002 Ga0307416_100001979 Ga0307416_1000019797 247
59 3300037312 Ga0395899_0102515 Ga0395899_0102515_625_1446 247
60 3300037312 Ga0395899_0351111 Ga0395899_0351111_75_818 247
61 3300037312 Ga0395899_0351132 Ga0395899_0351132_169_912 247
62 3300037418 Ga0395900_0838301 Ga0395900_0838301_34_777 247
63 3300037466 Ga0395898_0145363 Ga0395898_0145363_767_1510 247
64 3300037466 Ga0395898_0195547 Ga0395898_0195547_231_1052 247
65 3300037466 Ga0395898_0211788 Ga0395898_0211788_547_1290 247
66 3300037471 Ga0395905_0116961 Ga0395905_0116961_482_1225 247
67 3300037471 Ga0395905_0219356 Ga0395905_0219356_873_1694 247
68 3300038443 Ga0395901_0184791 Ga0395901_0184791_484_1305 247
69 3300038443 Ga0395901_1007520 Ga0395901_1007520_47_790 247
70 3300041452 Ga0451793_0056641 Ga0451793_0056641_1234_2013 247
71 3300046460 Ga0495638_0000228 Ga0495638_0000228_54103_54882 247
72 3300046525 Ga0495663_0008822 Ga0495663_0008822_1239_2018 247
73 3300046660 Ga0495625_0000054 Ga0495625_0000054_157320_158099 247
74 3300046660 Ga0495625_0023897 Ga0495625_0023897_687_1466 247
75 3300046689 Ga0495613_0001138 Ga0495613_0001138_9479_10303 247
76 3300046691 Ga0495670_0066792 Ga0495670_0066792_700_1479 247
77 3300047472 Ga0495686_0014275 Ga0495686_0014275_3647_4426 247
78 3300053134 Ga0500658_0005807 Ga0500658_0005807_722_1501 247
79 3300053136 Ga0500559_0021384 Ga0500559_0021384_540_1316 247
80 3300053136 Ga0500559_0048360 Ga0500559_0048360_1054_1824 247
81 3300053153 Ga0500616_0009416 Ga0500616_0009416_1876_2655 247
82 2162886012 MBSR1b_contig_10793118 MBSR1b_0542.00001560 248
83 2162886012 MBSR1b_contig_1304737 MBSR1b_0214.00007970 248
84 3300003214 JGI25165J46597_1000007 JGI25165J46597_1000007394 248
85 3300005293 Ga0065715_10138552 Ga0065715_101385521 248
86 3300005347 Ga0070668_100005891 Ga0070668_1000058916 248
87 3300006051 Ga0075364_10295150 Ga0075364_102951502 248
88 3300009094 Ga0111539_10299657 Ga0111539_102996572 248
89 3300014326 Ga0157380_10009206 Ga0157380_100092063 248
90 3300015690 Ga0183363_1004 Ga0183363_1004294 248
91 3300016635 Ga0183361_11239 Ga0183361_112392 248
92 3300025261 Ga0209233_1000026 Ga0209233_1000026393 248
93 3300025972 Ga0207668_10006811 Ga0207668_100068116 248
94 3300027876 Ga0209974_10042285 Ga0209974_100422852 248
95 3300028380 Ga0268265_10254410 Ga0268265_102544102 248
96 3300031456 Ga0307513_10314998 Ga0307513_103149981 248
97 3300031616 Ga0307508_10001382 Ga0307508_1000138211 248
98 3300031824 Ga0307413_10145013 Ga0307413_101450131 248
99 3300031901 Ga0307406_10350471 Ga0307406_103504712 248
100 3300031911 Ga0307412_10178917 Ga0307412_101789172 248
101 3300032002 Ga0307416_100417645 Ga0307416_1004176451 248
102 3300032004 Ga0307414_10233342 Ga0307414_102333422 248
103 3300033180 Ga0307510_10006886 Ga0307510_100068866 248
104 3300037471 Ga0395905_0000762 Ga0395905_0000762_3216_3965 248
105 3300041413 Ga0439465_0000021 Ga0439465_0000021_1900_2670 248
106 3300041997 Ga0439431_0002003 Ga0439431_0002003_3417_4187 248
107 3300042004 Ga0439445_0000025 Ga0439445_0000025_18699_19469 248
108 3300044656 Ga0466969_0017557 Ga0466969_0017557_2786_3535 248
109 3300044684 Ga0466966_0081016 Ga0466966_0081016_910_1659 248
110 3300044694 Ga0466963_0005621 Ga0466963_0005621_2372_3121 248
111 3300044694 Ga0466963_0017663 Ga0466963_0017663_1608_2357 248
112 3300045049 Ga0466959_0011848 Ga0466959_0011848_1858_2607 248
113 3300045836 Ga0466958_0009462 Ga0466958_0009462_992_1741 248
114 3300045976 Ga0466967_0284750 Ga0466967_0284750_231_980 248
115 3300046492 Ga0495585_0135478 Ga0495585_0135478_178_954 248
116 3300046506 Ga0495583_0031044 Ga0495583_0031044_1309_2076 248
117 3300046524 Ga0495648_0038951 Ga0495648_0038951_446_1213 248
118 3300046525 Ga0495663_0022198 Ga0495663_0022198_659_1438 248
119 3300046537 Ga0495598_0016419 Ga0495598_0016419_693_1472 248
120 3300046660 Ga0495625_0009806 Ga0495625_0009806_1586_2353 248
121 3300048928 Ga0496125_0166387 Ga0496125_0166387_171_1019 248
122 3300050491 nmdc:mga00v17_260974_c1 nmdc:mga00v17_260974_c1_212_958 248
123 3300050496 nmdc:mga07m45_241904_c1 nmdc:mga07m45_241904_c1_136_924 248
124 3300053087 Ga0500643_000837 Ga0500643_000837_5979_6746 248
125 3300053096 Ga0500641_0004156 Ga0500641_0004156_3336_4121 248
126 3300053119 Ga0500595_000725 Ga0500595_000725_12180_12956 248
127 3300053136 Ga0500559_0119372 Ga0500559_0119372_339_1142 248
128 3300053158 Ga0500627_0003192 Ga0500627_0003192_4011_4811 248
129 3300053730 Ga0500645_002209 Ga0500645_002209_1561_2349 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

51

260

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g5b-assembly2.cif.gz_B bacteriophage lambda ser/thr protein phosphatase 0.7212 19 238
2qjc-assembly1.cif.gz_A crystal structure of a putative diadenosine tetraphosphatase 0.7177 11 246
2qjc-assembly1.cif.gz_A crystal structure of a putative diadenosine tetraphosphatase 0.6996 11 246
5vjw-assembly1.cif.gz_A arabidopsis thaliana rhizobiales-like phosphatase 2 complexed with tungstate 0.6802 12 248
1g5b-assembly2.cif.gz_B bacteriophage lambda ser/thr protein phosphatase 0.6676 19 238
ID Description Score Start End Superfamily
af_P55798_6_218_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7383 19 246 3.60.21.10
2qjcA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7168 11 246 3.60.21.10
af_A4I019_330_570_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7094 12 246 3.60.21.10
1g5bA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7072 15 238 3.60.21.10
af_P55799_4_218_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.703 19 238 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A836TLL0-F1-model_v4 Serine/threonine protein phosphatase 0.9858 144 248 GO:0005737
GO:0008803
GO:0016791
GO:0110154
AF-A0A4V1U048-F1-model_v4 deleted 0.9841 154 248
AF-A0A344WI04-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.981 11 246 GO:0005737
GO:0008803
GO:0016791
GO:0110154
AF-A0A6I7W4E2-F1-model_v4 Serine/threonine protein phosphatase 0.9804 161 247 GO:0005737
GO:0008803
GO:0016791
GO:0110154
AF-A0A531KS89-F1-model_v4 Serine/threonine protein phosphatase 0.9728 139 246 GO:0005737
GO:0008803
GO:0016791
GO:0110154

Feature Viewer

pLDDT pTM Quality
94.41 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map